Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 949630..950284 | Replicon | chromosome |
| Accession | NZ_CP103465 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain 5392 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | F4T2L4 |
| Locus tag | M5T42_RS04700 | Protein ID | WP_000244765.1 |
| Coordinates | 949877..950284 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | F4T2L5 |
| Locus tag | M5T42_RS04695 | Protein ID | WP_000354050.1 |
| Coordinates | 949630..949896 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T42_RS04675 (945718) | 945718..947151 | - | 1434 | WP_001296350.1 | 6-phospho-beta-glucosidase BglA | - |
| M5T42_RS04680 (947196) | 947196..947507 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
| M5T42_RS04685 (947671) | 947671..948330 | + | 660 | WP_000250275.1 | hemolysin III family protein | - |
| M5T42_RS04690 (948407) | 948407..949387 | - | 981 | WP_000886080.1 | tRNA-modifying protein YgfZ | - |
| M5T42_RS04695 (949630) | 949630..949896 | + | 267 | WP_000354050.1 | FAD assembly factor SdhE | Antitoxin |
| M5T42_RS04700 (949877) | 949877..950284 | + | 408 | WP_000244765.1 | protein YgfX | Toxin |
| M5T42_RS04705 (950324) | 950324..950845 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| M5T42_RS04710 (950957) | 950957..951853 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| M5T42_RS04715 (951878) | 951878..952588 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M5T42_RS04720 (952594) | 952594..954327 | + | 1734 | WP_000813195.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16043.95 Da Isoelectric Point: 11.5202
>T255076 WP_000244765.1 NZ_CP103465:949877-950284 [Escherichia coli O25b:H4-ST131]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A454A7D7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061L3F4 |