Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 3542594..3543110 | Replicon | chromosome |
| Accession | NZ_CP103445 | ||
| Organism | Erwinia pyrifoliae strain CP201486 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | D2T7S6 |
| Locus tag | NYP84_RS16775 | Protein ID | WP_012669379.1 |
| Coordinates | 3542826..3543110 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | D2T7S5 |
| Locus tag | NYP84_RS16770 | Protein ID | WP_012669378.1 |
| Coordinates | 3542594..3542836 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYP84_RS16755 (NYP84_16755) | 3537911..3538273 | - | 363 | WP_226060675.1 | helix-turn-helix transcriptional regulator | - |
| NYP84_RS16760 (NYP84_16760) | 3538376..3541063 | + | 2688 | WP_259825859.1 | CHC2 zinc finger domain-containing protein | - |
| NYP84_RS16765 (NYP84_16765) | 3541278..3542333 | + | 1056 | WP_012669377.1 | site-specific tyrosine recombinase XerC | - |
| NYP84_RS16770 (NYP84_16770) | 3542594..3542836 | + | 243 | WP_012669378.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NYP84_RS16775 (NYP84_16775) | 3542826..3543110 | + | 285 | WP_012669379.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NYP84_RS16780 (NYP84_16780) | 3544177..3545217 | + | 1041 | WP_012666458.1 | IS630 family transposase | - |
| NYP84_RS16785 (NYP84_16785) | 3545342..3546694 | + | 1353 | WP_012669399.1 | adenylate/guanylate cyclase domain-containing protein | - |
| NYP84_RS16790 (NYP84_16790) | 3546964..3547368 | - | 405 | WP_012669259.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3496709..3558922 | 62213 | |
| - | flank | IS/Tn | - | - | 3544177..3545217 | 1040 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11123.03 Da Isoelectric Point: 10.3769
>T255054 WP_012669379.1 NZ_CP103445:3542826-3543110 [Erwinia pyrifoliae]
MSYELVFDPRALKEWKKLGATVREQFKKKLAEVLVNPRVESARLREYPDCYKIKLKSSGYRLVYQVQDEQLVVFVVATGK
RERLQVYRDAGKRL
MSYELVFDPRALKEWKKLGATVREQFKKKLAEVLVNPRVESARLREYPDCYKIKLKSSGYRLVYQVQDEQLVVFVVATGK
RERLQVYRDAGKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|