Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 3528578..3529094 | Replicon | chromosome |
| Accession | NZ_CP103445 | ||
| Organism | Erwinia pyrifoliae strain CP201486 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | D2T7S6 |
| Locus tag | NYP84_RS16690 | Protein ID | WP_012669379.1 |
| Coordinates | 3528810..3529094 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | D2T7S5 |
| Locus tag | NYP84_RS16685 | Protein ID | WP_012669378.1 |
| Coordinates | 3528578..3528820 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYP84_RS16670 (NYP84_16670) | 3523844..3524248 | - | 405 | WP_259817774.1 | helix-turn-helix transcriptional regulator | - |
| NYP84_RS16675 (NYP84_16675) | 3524370..3527063 | + | 2694 | WP_259825852.1 | CHC2 zinc finger domain-containing protein | - |
| NYP84_RS16680 (NYP84_16680) | 3527262..3528317 | + | 1056 | WP_259825854.1 | site-specific tyrosine recombinase XerC | - |
| NYP84_RS16685 (NYP84_16685) | 3528578..3528820 | + | 243 | WP_012669378.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NYP84_RS16690 (NYP84_16690) | 3528810..3529094 | + | 285 | WP_012669379.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NYP84_RS16695 (NYP84_16695) | 3529586..3529903 | + | 318 | WP_259816732.1 | hypothetical protein | - |
| NYP84_RS16700 (NYP84_16700) | 3529950..3530372 | + | 423 | WP_226060674.1 | hypothetical protein | - |
| NYP84_RS16705 (NYP84_16705) | 3530378..3530728 | + | 351 | WP_041474388.1 | hypothetical protein | - |
| NYP84_RS16710 (NYP84_16710) | 3530785..3531087 | - | 303 | WP_104945003.1 | SymE family type I addiction module toxin | - |
| NYP84_RS16715 (NYP84_16715) | 3531162..3531524 | - | 363 | WP_226060675.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3496709..3558922 | 62213 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11123.03 Da Isoelectric Point: 10.3769
>T255053 WP_012669379.1 NZ_CP103445:3528810-3529094 [Erwinia pyrifoliae]
MSYELVFDPRALKEWKKLGATVREQFKKKLAEVLVNPRVESARLREYPDCYKIKLKSSGYRLVYQVQDEQLVVFVVATGK
RERLQVYRDAGKRL
MSYELVFDPRALKEWKKLGATVREQFKKKLAEVLVNPRVESARLREYPDCYKIKLKSSGYRLVYQVQDEQLVVFVVATGK
RERLQVYRDAGKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|