Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 2845893..2846427 | Replicon | chromosome |
| Accession | NZ_CP103445 | ||
| Organism | Erwinia pyrifoliae strain CP201486 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | D2T5B9 |
| Locus tag | NYP84_RS13440 | Protein ID | WP_012668982.1 |
| Coordinates | 2845893..2846180 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | D2T5C0 |
| Locus tag | NYP84_RS13445 | Protein ID | WP_012668983.1 |
| Coordinates | 2846185..2846427 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYP84_RS13415 (NYP84_13415) | 2841211..2842410 | - | 1200 | WP_259825734.1 | S-methyl-5-thioribose kinase | - |
| NYP84_RS13420 (NYP84_13420) | 2842525..2843556 | + | 1032 | WP_259825735.1 | S-methyl-5-thioribose-1-phosphate isomerase | - |
| NYP84_RS13425 (NYP84_13425) | 2843607..2844149 | - | 543 | WP_259825736.1 | acireductone dioxygenase | - |
| NYP84_RS13430 (NYP84_13430) | 2844146..2844835 | - | 690 | WP_259825737.1 | acireductone synthase | - |
| NYP84_RS13435 (NYP84_13435) | 2844832..2845446 | - | 615 | WP_259817819.1 | methylthioribulose 1-phosphate dehydratase | - |
| NYP84_RS13440 (NYP84_13440) | 2845893..2846180 | - | 288 | WP_012668982.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NYP84_RS13445 (NYP84_13445) | 2846185..2846427 | - | 243 | WP_012668983.1 | plasmid stabilization protein | Antitoxin |
| NYP84_RS13450 (NYP84_13450) | 2846849..2848009 | + | 1161 | WP_259825738.1 | pyridoxal phosphate-dependent aminotransferase | - |
| NYP84_RS13455 (NYP84_13455) | 2847997..2848770 | + | 774 | WP_259817818.1 | amidohydrolase | - |
| NYP84_RS13460 (NYP84_13460) | 2848754..2850079 | - | 1326 | WP_259825739.1 | nucleobase:cation symporter-2 family protein | - |
| NYP84_RS13465 (NYP84_13465) | 2850112..2850447 | - | 336 | WP_259817816.1 | hydroxyisourate hydrolase | - |
| NYP84_RS13470 (NYP84_13470) | 2850444..2850938 | - | 495 | WP_259825740.1 | 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10939.91 Da Isoelectric Point: 10.7969
>T255051 WP_012668982.1 NZ_CP103445:c2846180-2845893 [Erwinia pyrifoliae]
MIYKVKIRAEALKEWHGLDSAVREQFSKKLKKLRENPHVPSARLTGIAGCYKIKLRSSGFRLVYQVIDEELIIAVVAVGK
RERSQAYKLASERLR
MIYKVKIRAEALKEWHGLDSAVREQFSKKLKKLRENPHVPSARLTGIAGCYKIKLRSSGFRLVYQVIDEELIIAVVAVGK
RERSQAYKLASERLR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|