Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 2717638..2718266 | Replicon | chromosome |
| Accession | NZ_CP103445 | ||
| Organism | Erwinia pyrifoliae strain CP201486 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | D2T444 |
| Locus tag | NYP84_RS12800 | Protein ID | WP_004156337.1 |
| Coordinates | 2718048..2718266 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | NYP84_RS12795 | Protein ID | WP_012668861.1 |
| Coordinates | 2717638..2718018 (+) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYP84_RS12775 (NYP84_12775) | 2712969..2716109 | + | 3141 | WP_012668857.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NYP84_RS12780 (NYP84_12780) | 2716264..2716524 | + | 261 | WP_012668858.1 | type B 50S ribosomal protein L31 | - |
| NYP84_RS12785 (NYP84_12785) | 2716535..2716681 | + | 147 | WP_012668859.1 | type B 50S ribosomal protein L36 | - |
| NYP84_RS12790 (NYP84_12790) | 2717138..2717491 | + | 354 | WP_012668860.1 | hypothetical protein | - |
| NYP84_RS12795 (NYP84_12795) | 2717638..2718018 | + | 381 | WP_012668861.1 | Hha toxicity modulator TomB | Antitoxin |
| NYP84_RS12800 (NYP84_12800) | 2718048..2718266 | + | 219 | WP_004156337.1 | HHA domain-containing protein | Toxin |
| NYP84_RS12810 (NYP84_12810) | 2718565..2718882 | + | 318 | WP_012668862.1 | MGMT family protein | - |
| NYP84_RS12815 (NYP84_12815) | 2718905..2719462 | - | 558 | WP_012668863.1 | YbaY family lipoprotein | - |
| NYP84_RS12820 (NYP84_12820) | 2719685..2720545 | + | 861 | WP_012668864.1 | acyl-CoA thioesterase II | - |
| NYP84_RS12825 (NYP84_12825) | 2720620..2721921 | - | 1302 | WP_012668865.1 | ammonium transporter AmtB | - |
| NYP84_RS12830 (NYP84_12830) | 2721944..2722282 | - | 339 | WP_012668866.1 | P-II family nitrogen regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8627.06 Da Isoelectric Point: 8.9007
>T255050 WP_004156337.1 NZ_CP103445:2718048-2718266 [Erwinia pyrifoliae]
MTDKLLTKTDYLMRLRRCRSIDTLERVIEKNKYELSDDELAVFYSAADHRLAELTMNKLYDKVPVAVWKFVR
MTDKLLTKTDYLMRLRRCRSIDTLERVIEKNKYELSDDELAVFYSAADHRLAELTMNKLYDKVPVAVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 14721.47 Da Isoelectric Point: 4.8834
>AT255050 WP_012668861.1 NZ_CP103445:2717638-2718018 [Erwinia pyrifoliae]
MDEYSPKRHDIAQLKFLCENLYDESLATLGDSHHGWVNDPTSTSNLQLNDLIEHIAAFTMNYKIKHIEDCDLISQIDEYL
DDTFMLFSNYGVNTHDLQRWQKSAKRLFNIFAKECLMSQVQSSHSF
MDEYSPKRHDIAQLKFLCENLYDESLATLGDSHHGWVNDPTSTSNLQLNDLIEHIAAFTMNYKIKHIEDCDLISQIDEYL
DDTFMLFSNYGVNTHDLQRWQKSAKRLFNIFAKECLMSQVQSSHSF
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|