Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 2254737..2255347 | Replicon | chromosome |
| Accession | NZ_CP103445 | ||
| Organism | Erwinia pyrifoliae strain CP201486 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NYP84_RS10455 | Protein ID | WP_259818088.1 |
| Coordinates | 2254737..2255048 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NYP84_RS10460 | Protein ID | WP_259818087.1 |
| Coordinates | 2255051..2255347 (+) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYP84_RS10430 (NYP84_10430) | 2250949..2251443 | - | 495 | Protein_2015 | transposase | - |
| NYP84_RS10435 (NYP84_10435) | 2252158..2252410 | - | 253 | Protein_2016 | IS110 family transposase | - |
| NYP84_RS10440 (NYP84_10440) | 2252514..2253422 | - | 909 | WP_012668491.1 | hypothetical protein | - |
| NYP84_RS10445 (NYP84_10445) | 2253721..2254037 | + | 317 | Protein_2018 | contractile injection system protein, VgrG/Pvc8 family | - |
| NYP84_RS10450 (NYP84_10450) | 2254077..2254325 | + | 249 | WP_012668492.1 | ogr/Delta-like zinc finger family protein | - |
| NYP84_RS10455 (NYP84_10455) | 2254737..2255048 | + | 312 | WP_259818088.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NYP84_RS10460 (NYP84_10460) | 2255051..2255347 | + | 297 | WP_259818087.1 | NadS family protein | Antitoxin |
| NYP84_RS10465 (NYP84_10465) | 2255405..2255653 | - | 249 | WP_012668492.1 | ogr/Delta-like zinc finger family protein | - |
| NYP84_RS10470 (NYP84_10470) | 2255693..2256829 | - | 1137 | WP_259825660.1 | phage late control D family protein | - |
| NYP84_RS10475 (NYP84_10475) | 2256981..2258162 | + | 1182 | WP_259818085.1 | phage tail sheath family protein | - |
| NYP84_RS10480 (NYP84_10480) | 2258163..2258678 | + | 516 | WP_259818084.1 | phage major tail tube protein | - |
| NYP84_RS10485 (NYP84_10485) | 2258726..2259043 | + | 318 | WP_259825661.1 | phage tail assembly protein | - |
| NYP84_RS10490 (NYP84_10490) | 2259049..2259204 | + | 156 | WP_168400670.1 | GpE family phage tail protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2247065..2288527 | 41462 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12033.69 Da Isoelectric Point: 7.0154
>T255048 WP_259818088.1 NZ_CP103445:2254737-2255048 [Erwinia pyrifoliae]
MLFIETAIFTEDVKELLTDDEYREFQQFLADNPGWGDVIQQTGGLRKVRWSAKGKGKRGGVRVIYFHKVSESQIRLLLIY
KKGIQDDLSDDEKRQLRTLNEGW
MLFIETAIFTEDVKELLTDDEYREFQQFLADNPGWGDVIQQTGGLRKVRWSAKGKGKRGGVRVIYFHKVSESQIRLLLIY
KKGIQDDLSDDEKRQLRTLNEGW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|