Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5433283..5433908 | Replicon | chromosome |
| Accession | NZ_CP103419 | ||
| Organism | Klebsiella variicola strain KV4 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A1F2M041 |
| Locus tag | NYO13_RS26160 | Protein ID | WP_008807903.1 |
| Coordinates | 5433283..5433666 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | NYO13_RS26165 | Protein ID | WP_004150355.1 |
| Coordinates | 5433666..5433908 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYO13_RS26145 (NYO13_26145) | 5430649..5431551 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| NYO13_RS26150 (NYO13_26150) | 5431548..5432183 | + | 636 | WP_008807902.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NYO13_RS26155 (NYO13_26155) | 5432180..5433109 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| NYO13_RS26160 (NYO13_26160) | 5433283..5433666 | - | 384 | WP_008807903.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NYO13_RS26165 (NYO13_26165) | 5433666..5433908 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| NYO13_RS26170 (NYO13_26170) | 5434113..5435030 | + | 918 | WP_048331367.1 | alpha/beta hydrolase | - |
| NYO13_RS26175 (NYO13_26175) | 5435045..5435986 | - | 942 | WP_012543287.1 | fatty acid biosynthesis protein FabY | - |
| NYO13_RS26180 (NYO13_26180) | 5436031..5436468 | - | 438 | WP_008807906.1 | D-aminoacyl-tRNA deacylase | - |
| NYO13_RS26185 (NYO13_26185) | 5436465..5437325 | - | 861 | WP_008807907.1 | virulence factor BrkB family protein | - |
| NYO13_RS26190 (NYO13_26190) | 5437319..5437918 | - | 600 | WP_008807908.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T255027 WP_008807903.1 NZ_CP103419:c5433666-5433283 [Klebsiella variicola]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYELHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYELHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1F2M041 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |