Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 274583..275222 | Replicon | chromosome |
| Accession | NZ_CP103291 | ||
| Organism | Peribacillus frigoritolerans strain NS1 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | NWE71_RS01420 | Protein ID | WP_034306610.1 |
| Coordinates | 274872..275222 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | NWE71_RS01415 | Protein ID | WP_034306380.1 |
| Coordinates | 274583..274864 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWE71_RS01395 | 270722..271312 | - | 591 | WP_057277208.1 | rhomboid family intramembrane serine protease | - |
| NWE71_RS01400 | 271420..271770 | + | 351 | WP_053537119.1 | holo-ACP synthase | - |
| NWE71_RS01405 | 272013..273017 | + | 1005 | WP_095396324.1 | outer membrane lipoprotein carrier protein LolA | - |
| NWE71_RS01410 | 273235..274422 | + | 1188 | WP_258832640.1 | alanine racemase | - |
| NWE71_RS01415 | 274583..274864 | + | 282 | WP_034306380.1 | antitoxin EndoAI | Antitoxin |
| NWE71_RS01420 | 274872..275222 | + | 351 | WP_034306610.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NWE71_RS01425 | 275639..276466 | + | 828 | WP_048682050.1 | RsbT co-antagonist protein RsbRA | - |
| NWE71_RS01430 | 276469..276825 | + | 357 | WP_048682053.1 | STAS domain-containing protein | - |
| NWE71_RS01435 | 276829..277230 | + | 402 | WP_048682056.1 | anti-sigma regulatory factor | - |
| NWE71_RS01440 | 277240..278250 | + | 1011 | WP_258832641.1 | PP2C family protein-serine/threonine phosphatase | - |
| NWE71_RS01445 | 278310..278642 | + | 333 | WP_034306369.1 | anti-sigma factor antagonist | - |
| NWE71_RS01450 | 278639..279112 | + | 474 | WP_034306366.1 | anti-sigma B factor RsbW | - |
| NWE71_RS01455 | 279090..279878 | + | 789 | WP_258832642.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12955.06 Da Isoelectric Point: 7.2029
>T254858 WP_034306610.1 NZ_CP103291:274872-275222 [Peribacillus frigoritolerans]
IVVKRGDVYFADLSPVVGSEQGGTRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEPMMQKVNEALQISLGLIEF
IVVKRGDVYFADLSPVVGSEQGGTRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEPMMQKVNEALQISLGLIEF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|