Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2447091..2447275 | Replicon | chromosome |
| Accession | NZ_CP102953 | ||
| Organism | Staphylococcus aureus strain 32-T-13 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | Q2FVI9 |
| Locus tag | NW977_RS12120 | Protein ID | WP_000482650.1 |
| Coordinates | 2447168..2447275 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2447091..2447151 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW977_RS12110 (NW977_12110) | 2443019..2444752 | - | 1734 | WP_258414933.1 | ABC transporter ATP-binding protein | - |
| NW977_RS12115 (NW977_12115) | 2444777..2446540 | - | 1764 | WP_258414934.1 | ABC transporter ATP-binding protein | - |
| - | 2447091..2447151 | + | 61 | - | - | Antitoxin |
| NW977_RS12120 (NW977_12120) | 2447168..2447275 | - | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| NW977_RS12125 (NW977_12125) | 2447409..2447795 | - | 387 | WP_000779358.1 | flippase GtxA | - |
| NW977_RS12130 (NW977_12130) | 2448063..2449205 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
| NW977_RS12135 (NW977_12135) | 2449265..2449924 | + | 660 | WP_000831298.1 | membrane protein | - |
| NW977_RS12140 (NW977_12140) | 2450106..2451317 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
| NW977_RS12145 (NW977_12145) | 2451440..2451913 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T254604 WP_000482650.1 NZ_CP102953:c2447275-2447168 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT254604 NZ_CP102953:2447091-2447151 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|