Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2438771..2438955 | Replicon | chromosome |
| Accession | NZ_CP102952 | ||
| Organism | Staphylococcus aureus strain 39-B-49 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | Q2FVI9 |
| Locus tag | NW967_RS12010 | Protein ID | WP_000482650.1 |
| Coordinates | 2438848..2438955 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2438771..2438831 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW967_RS11995 (NW967_11995) | 2434225..2434392 | - | 168 | WP_001790576.1 | hypothetical protein | - |
| NW967_RS12000 (NW967_12000) | 2434623..2436356 | - | 1734 | WP_258411336.1 | ABC transporter ATP-binding protein | - |
| NW967_RS12005 (NW967_12005) | 2436381..2438144 | - | 1764 | WP_258411337.1 | ABC transporter ATP-binding protein | - |
| - | 2438771..2438831 | + | 61 | - | - | Antitoxin |
| NW967_RS12010 (NW967_12010) | 2438848..2438955 | - | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| NW967_RS12015 (NW967_12015) | 2439089..2439475 | - | 387 | WP_000779360.1 | flippase GtxA | - |
| NW967_RS12020 (NW967_12020) | 2439733..2440875 | + | 1143 | WP_258411344.1 | glycerate kinase | - |
| NW967_RS12025 (NW967_12025) | 2440935..2441594 | + | 660 | WP_000831298.1 | membrane protein | - |
| NW967_RS12030 (NW967_12030) | 2441776..2442987 | + | 1212 | WP_258411345.1 | multidrug effflux MFS transporter | - |
| NW967_RS12035 (NW967_12035) | 2443110..2443583 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T254593 WP_000482650.1 NZ_CP102952:c2438955-2438848 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT254593 NZ_CP102952:2438771-2438831 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|