Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 13919..14158 Replicon plasmid unnamed1
Accession NZ_CP102948
Organism Escherichia coli strain SCAID WND1-2022 (119)

Toxin (Protein)


Gene name srnB Uniprot ID A0A762TWR7
Locus tag NW339_RS24675 Protein ID WP_023144756.1
Coordinates 14024..14158 (+) Length 45 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 13919..13979 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW339_RS24645 (9710) 9710..10270 + 561 WP_000139341.1 fertility inhibition protein FinO -
NW339_RS24650 (10401) 10401..10613 + 213 WP_013023861.1 hypothetical protein -
NW339_RS24655 (11172) 11172..11597 + 426 WP_000422741.1 transposase -
NW339_RS24660 (11594) 11594..11944 + 351 WP_000624722.1 IS66 family insertion sequence element accessory protein TnpB -
NW339_RS24665 (11975) 11975..13588 + 1614 WP_000080195.1 IS66-like element ISEc23 family transposase -
NW339_RS24670 (13666) 13666..13952 + 287 Protein_10 DUF2726 domain-containing protein -
- (13919) 13919..13979 - 61 NuclAT_0 - Antitoxin
- (13919) 13919..13979 - 61 NuclAT_0 - Antitoxin
- (13919) 13919..13979 - 61 NuclAT_0 - Antitoxin
- (13919) 13919..13979 - 61 NuclAT_0 - Antitoxin
NW339_RS24675 (14024) 14024..14158 + 135 WP_023144756.1 Hok/Gef family protein Toxin
NW339_RS24680 (14455) 14455..14709 + 255 WP_000083850.1 replication regulatory protein RepA -
NW339_RS24685 (14815) 14815..14946 + 132 Protein_13 protein CopA/IncA -
NW339_RS24690 (14946) 14946..15020 + 75 WP_031943482.1 RepA leader peptide Tap -
NW339_RS24695 (15013) 15013..15870 + 858 WP_001617855.1 incFII family plasmid replication initiator RepA -
NW339_RS24700 (16810) 16810..17463 + 654 WP_000616807.1 CPBP family intramembrane metalloprotease -
NW339_RS24705 (17556) 17556..17813 + 258 WP_000557619.1 type II toxin-antitoxin system antitoxin PemI -
NW339_RS24710 (17746) 17746..18147 + 402 WP_001398199.1 type II toxin-antitoxin system toxin endoribonuclease PemK -
NW339_RS24715 (18396) 18396..18811 + 416 Protein_19 IS1 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaCTX-M-27 senB 1..105437 105437


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-44)


Sequences

Toxin        


Download         Length: 45 a.a.        Molecular weight: 4896.90 Da        Isoelectric Point: 7.7209

>T254572 WP_023144756.1 NZ_CP102948:14024-14158 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Download         Length: 135 bp

Antitoxin


Download         Length: 61 bp

>AT254572 NZ_CP102948:c13979-13919 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A762TWR7

Antitoxin

Download structure file

References