Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 122561..122815 | Replicon | plasmid pXH989-CTX |
| Accession | NZ_CP102676 | ||
| Organism | Escherichia coli strain XH989 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NU949_RS00745 | Protein ID | WP_001312851.1 |
| Coordinates | 122561..122710 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 122754..122815 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NU949_RS00700 (118111) | 118111..118512 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| NU949_RS00705 (118445) | 118445..118702 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| NU949_RS00710 (118795) | 118795..118986 | - | 192 | WP_001376180.1 | CPBP family glutamic-type intramembrane protease | - |
| NU949_RS00715 (118968) | 118968..119450 | - | 483 | WP_228252671.1 | histidine phosphatase family protein | - |
| NU949_RS00720 (120389) | 120389..121246 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| NU949_RS00725 (121239) | 121239..121721 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| NU949_RS00730 (121714) | 121714..121761 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| NU949_RS00735 (121752) | 121752..122003 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| NU949_RS00740 (122020) | 122020..122277 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| NU949_RS00745 (122561) | 122561..122710 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (122754) | 122754..122815 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (122754) | 122754..122815 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (122754) | 122754..122815 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (122754) | 122754..122815 | + | 62 | NuclAT_1 | - | Antitoxin |
| NU949_RS00750 (123071) | 123071..123145 | - | 75 | Protein_149 | endonuclease | - |
| NU949_RS00755 (123391) | 123391..123603 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| NU949_RS00760 (123739) | 123739..124299 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| NU949_RS00765 (124402) | 124402..125262 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| NU949_RS00770 (125321) | 125321..126067 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / rmtB / aac(3)-IId / aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / fosA3 / blaCTX-M-65 / sitABCD | iroN / iroE / iroD / iroC / iroB / iutA / iucD / iucC / iucB / iucA | 1..188009 | 188009 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T253961 WP_001312851.1 NZ_CP102676:c122710-122561 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT253961 NZ_CP102676:122754-122815 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
