Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 3331384..3332015 | Replicon | chromosome |
| Accession | NZ_CP102479 | ||
| Organism | Klebsiella aerogenes strain TS2020 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A1Q8YTV3 |
| Locus tag | NUT96_RS16010 | Protein ID | WP_012542177.1 |
| Coordinates | 3331839..3332015 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NUT96_RS16005 | Protein ID | WP_041165571.1 |
| Coordinates | 3331384..3331791 (-) | Length | 136 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUT96_RS15965 (3327965) | 3327965..3328453 | - | 489 | WP_032448881.1 | DUF1441 family protein | - |
| NUT96_RS15970 (3328416) | 3328416..3328664 | - | 249 | WP_155958735.1 | hypothetical protein | - |
| NUT96_RS15975 (3328685) | 3328685..3329104 | - | 420 | WP_257739469.1 | hypothetical protein | - |
| NUT96_RS15980 (3329104) | 3329104..3329436 | - | 333 | WP_257739470.1 | hypothetical protein | - |
| NUT96_RS15985 (3329610) | 3329610..3329852 | + | 243 | WP_257739472.1 | hypothetical protein | - |
| NUT96_RS15990 (3329984) | 3329984..3330499 | - | 516 | WP_257739473.1 | DUF2514 domain-containing protein | - |
| NUT96_RS15995 (3330496) | 3330496..3331029 | - | 534 | WP_257739474.1 | lysozyme | - |
| NUT96_RS16000 (3331031) | 3331031..3331279 | - | 249 | WP_032706073.1 | class II holin family protein | - |
| NUT96_RS16005 (3331384) | 3331384..3331791 | - | 408 | WP_041165571.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NUT96_RS16010 (3331839) | 3331839..3332015 | - | 177 | WP_012542177.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NUT96_RS16015 (3332383) | 3332383..3332985 | - | 603 | WP_257739581.1 | hypothetical protein | - |
| NUT96_RS16020 (3332999) | 3332999..3334030 | - | 1032 | WP_257739475.1 | DUF968 domain-containing protein | - |
| NUT96_RS16025 (3334030) | 3334030..3334233 | - | 204 | WP_015367393.1 | hypothetical protein | - |
| NUT96_RS16030 (3334230) | 3334230..3334622 | - | 393 | WP_058649374.1 | DNA-binding protein | - |
| NUT96_RS16035 (3334663) | 3334663..3334920 | - | 258 | WP_101743419.1 | hypothetical protein | - |
| NUT96_RS16040 (3334966) | 3334966..3335199 | - | 234 | WP_257739476.1 | DinI family protein | - |
| NUT96_RS16045 (3335352) | 3335352..3335681 | - | 330 | WP_072140433.1 | hypothetical protein | - |
| NUT96_RS16050 (3335874) | 3335874..3336398 | - | 525 | WP_071059009.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3296012..3345420 | 49408 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6632.83 Da Isoelectric Point: 11.0174
>T253717 WP_012542177.1 NZ_CP102479:c3332015-3331839 [Klebsiella aerogenes]
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK
Download Length: 177 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 15020.03 Da Isoelectric Point: 4.4368
>AT253717 WP_041165571.1 NZ_CP102479:c3331791-3331384 [Klebsiella aerogenes]
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSADGEAFVEVPSSVAAKVLLL
NRLVSTNTSNAELARMINTRPQEVQRIVSLGHSTKIDTIQKALAALGQHMEIVVR
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSADGEAFVEVPSSVAAKVLLL
NRLVSTNTSNAELARMINTRPQEVQRIVSLGHSTKIDTIQKALAALGQHMEIVVR
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|