Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/UPF0150(antitoxin)
Location 3331384..3332015 Replicon chromosome
Accession NZ_CP102479
Organism Klebsiella aerogenes strain TS2020

Toxin (Protein)


Gene name hicA Uniprot ID A0A1Q8YTV3
Locus tag NUT96_RS16010 Protein ID WP_012542177.1
Coordinates 3331839..3332015 (-) Length 59 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag NUT96_RS16005 Protein ID WP_041165571.1
Coordinates 3331384..3331791 (-) Length 136 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUT96_RS15965 (3327965) 3327965..3328453 - 489 WP_032448881.1 DUF1441 family protein -
NUT96_RS15970 (3328416) 3328416..3328664 - 249 WP_155958735.1 hypothetical protein -
NUT96_RS15975 (3328685) 3328685..3329104 - 420 WP_257739469.1 hypothetical protein -
NUT96_RS15980 (3329104) 3329104..3329436 - 333 WP_257739470.1 hypothetical protein -
NUT96_RS15985 (3329610) 3329610..3329852 + 243 WP_257739472.1 hypothetical protein -
NUT96_RS15990 (3329984) 3329984..3330499 - 516 WP_257739473.1 DUF2514 domain-containing protein -
NUT96_RS15995 (3330496) 3330496..3331029 - 534 WP_257739474.1 lysozyme -
NUT96_RS16000 (3331031) 3331031..3331279 - 249 WP_032706073.1 class II holin family protein -
NUT96_RS16005 (3331384) 3331384..3331791 - 408 WP_041165571.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NUT96_RS16010 (3331839) 3331839..3332015 - 177 WP_012542177.1 type II toxin-antitoxin system HicA family toxin Toxin
NUT96_RS16015 (3332383) 3332383..3332985 - 603 WP_257739581.1 hypothetical protein -
NUT96_RS16020 (3332999) 3332999..3334030 - 1032 WP_257739475.1 DUF968 domain-containing protein -
NUT96_RS16025 (3334030) 3334030..3334233 - 204 WP_015367393.1 hypothetical protein -
NUT96_RS16030 (3334230) 3334230..3334622 - 393 WP_058649374.1 DNA-binding protein -
NUT96_RS16035 (3334663) 3334663..3334920 - 258 WP_101743419.1 hypothetical protein -
NUT96_RS16040 (3334966) 3334966..3335199 - 234 WP_257739476.1 DinI family protein -
NUT96_RS16045 (3335352) 3335352..3335681 - 330 WP_072140433.1 hypothetical protein -
NUT96_RS16050 (3335874) 3335874..3336398 - 525 WP_071059009.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3296012..3345420 49408


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-57)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-61)


Sequences

Toxin        


Download         Length: 59 a.a.        Molecular weight: 6632.83 Da        Isoelectric Point: 11.0174

>T253717 WP_012542177.1 NZ_CP102479:c3332015-3331839 [Klebsiella aerogenes]
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK

Download         Length: 177 bp

Antitoxin


Download         Length: 136 a.a.        Molecular weight: 15020.03 Da        Isoelectric Point: 4.4368

>AT253717 WP_041165571.1 NZ_CP102479:c3331791-3331384 [Klebsiella aerogenes]
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSADGEAFVEVPSSVAAKVLLL
NRLVSTNTSNAELARMINTRPQEVQRIVSLGHSTKIDTIQKALAALGQHMEIVVR

Download         Length: 408 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1Q8YTV3

Antitoxin

Source ID Structure

References