Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2579956..2580695 | Replicon | chromosome |
Accession | NZ_CP102479 | ||
Organism | Klebsiella aerogenes strain TS2020 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | NUT96_RS12320 | Protein ID | WP_032705770.1 |
Coordinates | 2580210..2580695 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A0H3FSM9 |
Locus tag | NUT96_RS12315 | Protein ID | WP_015705366.1 |
Coordinates | 2579956..2580222 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUT96_RS12290 (2575291) | 2575291..2575878 | + | 588 | WP_015705371.1 | hypothetical protein | - |
NUT96_RS12295 (2575875) | 2575875..2577194 | + | 1320 | WP_015705370.1 | ATP-binding protein | - |
NUT96_RS12300 (2577194) | 2577194..2577811 | + | 618 | WP_015705369.1 | response regulator | - |
NUT96_RS12305 (2577907) | 2577907..2578404 | + | 498 | WP_032708018.1 | heme-binding protein | - |
NUT96_RS12310 (2578448) | 2578448..2579683 | - | 1236 | WP_020078885.1 | MFS transporter | - |
NUT96_RS12315 (2579956) | 2579956..2580222 | + | 267 | WP_015705366.1 | DUF1778 domain-containing protein | Antitoxin |
NUT96_RS12320 (2580210) | 2580210..2580695 | + | 486 | WP_032705770.1 | GNAT family N-acetyltransferase | Toxin |
NUT96_RS12325 (2580767) | 2580767..2582383 | + | 1617 | WP_032708017.1 | FAD-NAD(P)-binding protein | - |
NUT96_RS12330 (2582502) | 2582502..2583602 | + | 1101 | WP_032708016.1 | NADH:flavin oxidoreductase/NADH oxidase | - |
NUT96_RS12335 (2583659) | 2583659..2583817 | - | 159 | WP_002903230.1 | YqaE/Pmp3 family membrane protein | - |
NUT96_RS12340 (2584078) | 2584078..2585148 | + | 1071 | WP_075648509.1 | mannonate dehydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17573.23 Da Isoelectric Point: 8.8793
>T253716 WP_032705770.1 NZ_CP102479:2580210-2580695 [Klebsiella aerogenes]
MGKISAPAPLSSHHQIAEFCCGETVLDQWLKQRGLKNQAQGAARTFVVCKEESHQVVGFYSLATGSVNHSEATGGLRRNM
PDPIPVIILARLAIDCAFHGQGLGADLLHDALLRSYRVAENVGVRALMVHALTDSAKRFYLHHGFKASTTQERTLFLALP
K
MGKISAPAPLSSHHQIAEFCCGETVLDQWLKQRGLKNQAQGAARTFVVCKEESHQVVGFYSLATGSVNHSEATGGLRRNM
PDPIPVIILARLAIDCAFHGQGLGADLLHDALLRSYRVAENVGVRALMVHALTDSAKRFYLHHGFKASTTQERTLFLALP
K
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|