Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 3035154..3035793 | Replicon | chromosome |
| Accession | NZ_CP102463 | ||
| Organism | Burkholderia contaminans strain NML151013 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NUJ29_RS31760 | Protein ID | WP_226285408.1 |
| Coordinates | 3035154..3035570 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A1X1PQC0 |
| Locus tag | NUJ29_RS31765 | Protein ID | WP_039351245.1 |
| Coordinates | 3035557..3035793 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUJ29_RS31735 (NUJ29_31735) | 3030321..3031409 | - | 1089 | WP_105816535.1 | nitronate monooxygenase | - |
| NUJ29_RS31740 (NUJ29_31740) | 3031406..3032338 | - | 933 | WP_071332494.1 | enoyl-CoA hydratase | - |
| NUJ29_RS31745 (NUJ29_31745) | 3032347..3033144 | - | 798 | WP_105816536.1 | ketoacid CoA transferase | - |
| NUJ29_RS31750 (NUJ29_31750) | 3033155..3034048 | - | 894 | WP_046547957.1 | CoA-transferase | - |
| NUJ29_RS31755 (NUJ29_31755) | 3034058..3034954 | - | 897 | WP_039350875.1 | VOC family protein | - |
| NUJ29_RS31760 (NUJ29_31760) | 3035154..3035570 | - | 417 | WP_226285408.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NUJ29_RS31765 (NUJ29_31765) | 3035557..3035793 | - | 237 | WP_039351245.1 | DNA-binding protein | Antitoxin |
| NUJ29_RS31770 (NUJ29_31770) | 3036191..3036577 | - | 387 | Protein_2724 | hypothetical protein | - |
| NUJ29_RS31775 (NUJ29_31775) | 3036738..3037973 | + | 1236 | WP_105816538.1 | acyltransferase | - |
| NUJ29_RS31780 (NUJ29_31780) | 3038050..3038823 | - | 774 | WP_105816539.1 | SDR family oxidoreductase | - |
| NUJ29_RS31785 (NUJ29_31785) | 3038862..3040442 | - | 1581 | WP_105816540.1 | FadD3 family acyl-CoA ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15312.64 Da Isoelectric Point: 8.5735
>T253693 WP_226285408.1 NZ_CP102463:c3035570-3035154 [Burkholderia contaminans]
VYLIDTNIISEIRKGKRTNRGVRAFFRQAAADASPLYLSVVTVAELRRGVDLIRHRGDHPQASALEAWMATILSGYAPNI
LPVDIEISQMWGHLRVPDPTHELDKLIAATALINDLTVVTRNVADFARTGVKLLNPFD
VYLIDTNIISEIRKGKRTNRGVRAFFRQAAADASPLYLSVVTVAELRRGVDLIRHRGDHPQASALEAWMATILSGYAPNI
LPVDIEISQMWGHLRVPDPTHELDKLIAATALINDLTVVTRNVADFARTGVKLLNPFD
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|