Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 305940..306595 | Replicon | chromosome |
| Accession | NZ_CP102463 | ||
| Organism | Burkholderia contaminans strain NML151013 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NUJ29_RS19450 | Protein ID | WP_105818098.1 |
| Coordinates | 305940..306359 (-) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NUJ29_RS19455 | Protein ID | WP_105818099.1 |
| Coordinates | 306356..306595 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUJ29_RS19425 (NUJ29_19425) | 301341..302135 | + | 795 | WP_105818096.1 | AraC family transcriptional regulator | - |
| NUJ29_RS19430 (NUJ29_19430) | 302335..303303 | + | 969 | WP_224756093.1 | DMT family transporter | - |
| NUJ29_RS19435 (NUJ29_19435) | 303512..304060 | + | 549 | WP_105818378.1 | permease | - |
| NUJ29_RS19440 (NUJ29_19440) | 304159..304293 | - | 135 | WP_006485835.1 | entericidin A/B family lipoprotein | - |
| NUJ29_RS19445 (NUJ29_19445) | 304527..305822 | + | 1296 | WP_039360985.1 | aspartate carbamoyltransferase | - |
| NUJ29_RS19450 (NUJ29_19450) | 305940..306359 | - | 420 | WP_105818098.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NUJ29_RS19455 (NUJ29_19455) | 306356..306595 | - | 240 | WP_105818099.1 | Arc family DNA-binding protein | Antitoxin |
| NUJ29_RS19460 (NUJ29_19460) | 306907..309150 | + | 2244 | WP_105818100.1 | TonB-dependent siderophore receptor | - |
| NUJ29_RS19465 (NUJ29_19465) | 309154..309900 | + | 747 | WP_105818101.1 | tetratricopeptide repeat protein | - |
| NUJ29_RS19470 (NUJ29_19470) | 309930..310613 | + | 684 | WP_105818102.1 | Fe2+-dependent dioxygenase | - |
| NUJ29_RS19475 (NUJ29_19475) | 310710..310949 | + | 240 | WP_011659184.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| NUJ29_RS19480 (NUJ29_19480) | 310946..311341 | + | 396 | WP_039361042.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15079.31 Da Isoelectric Point: 5.7471
>T253690 WP_105818098.1 NZ_CP102463:c306359-305940 [Burkholderia contaminans]
MILVDTNVMSEPLRREPSTAVIEWLDAQNVETLFLAAISLGEMRFGVAALPEGRRRDWLHHGIEQRVVPLFRGRILPFDD
AASKAYASIRARARASGSAIAPADVFIAATAEANGLIIATRDGAPFEAVGLRVIDPWAS
MILVDTNVMSEPLRREPSTAVIEWLDAQNVETLFLAAISLGEMRFGVAALPEGRRRDWLHHGIEQRVVPLFRGRILPFDD
AASKAYASIRARARASGSAIAPADVFIAATAEANGLIIATRDGAPFEAVGLRVIDPWAS
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|