Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1143341..1143563 | Replicon | chromosome |
| Accession | NZ_CP102379 | ||
| Organism | Escherichia coli strain BM28 lysU | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | J7R083 |
| Locus tag | NR350_RS05535 | Protein ID | WP_000170963.1 |
| Coordinates | 1143341..1143448 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1143496..1143563 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NR350_RS05505 (1138650) | 1138650..1139732 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| NR350_RS05510 (1139732) | 1139732..1140565 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| NR350_RS05515 (1140562) | 1140562..1140954 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| NR350_RS05520 (1140958) | 1140958..1141767 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| NR350_RS05525 (1141803) | 1141803..1142657 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| NR350_RS05530 (1142806) | 1142806..1142913 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1142961) | 1142961..1143027 | + | 67 | NuclAT_33 | - | - |
| - (1142961) | 1142961..1143027 | + | 67 | NuclAT_33 | - | - |
| - (1142961) | 1142961..1143027 | + | 67 | NuclAT_33 | - | - |
| - (1142961) | 1142961..1143027 | + | 67 | NuclAT_33 | - | - |
| - (1142961) | 1142961..1143027 | + | 67 | NuclAT_35 | - | - |
| - (1142961) | 1142961..1143027 | + | 67 | NuclAT_35 | - | - |
| - (1142961) | 1142961..1143027 | + | 67 | NuclAT_35 | - | - |
| - (1142961) | 1142961..1143027 | + | 67 | NuclAT_35 | - | - |
| - (1142961) | 1142961..1143027 | + | 67 | NuclAT_37 | - | - |
| - (1142961) | 1142961..1143027 | + | 67 | NuclAT_37 | - | - |
| - (1142961) | 1142961..1143027 | + | 67 | NuclAT_37 | - | - |
| - (1142961) | 1142961..1143027 | + | 67 | NuclAT_37 | - | - |
| - (1142961) | 1142961..1143027 | + | 67 | NuclAT_39 | - | - |
| - (1142961) | 1142961..1143027 | + | 67 | NuclAT_39 | - | - |
| - (1142961) | 1142961..1143027 | + | 67 | NuclAT_39 | - | - |
| - (1142961) | 1142961..1143027 | + | 67 | NuclAT_39 | - | - |
| - (1142961) | 1142961..1143027 | + | 67 | NuclAT_41 | - | - |
| - (1142961) | 1142961..1143027 | + | 67 | NuclAT_41 | - | - |
| - (1142961) | 1142961..1143027 | + | 67 | NuclAT_41 | - | - |
| - (1142961) | 1142961..1143027 | + | 67 | NuclAT_41 | - | - |
| - (1142961) | 1142961..1143027 | + | 67 | NuclAT_43 | - | - |
| - (1142961) | 1142961..1143027 | + | 67 | NuclAT_43 | - | - |
| - (1142961) | 1142961..1143027 | + | 67 | NuclAT_43 | - | - |
| - (1142961) | 1142961..1143027 | + | 67 | NuclAT_43 | - | - |
| - (1142963) | 1142963..1143028 | + | 66 | NuclAT_17 | - | - |
| - (1142963) | 1142963..1143028 | + | 66 | NuclAT_17 | - | - |
| - (1142963) | 1142963..1143028 | + | 66 | NuclAT_17 | - | - |
| - (1142963) | 1142963..1143028 | + | 66 | NuclAT_17 | - | - |
| - (1142963) | 1142963..1143028 | + | 66 | NuclAT_20 | - | - |
| - (1142963) | 1142963..1143028 | + | 66 | NuclAT_20 | - | - |
| - (1142963) | 1142963..1143028 | + | 66 | NuclAT_20 | - | - |
| - (1142963) | 1142963..1143028 | + | 66 | NuclAT_20 | - | - |
| - (1142963) | 1142963..1143028 | + | 66 | NuclAT_23 | - | - |
| - (1142963) | 1142963..1143028 | + | 66 | NuclAT_23 | - | - |
| - (1142963) | 1142963..1143028 | + | 66 | NuclAT_23 | - | - |
| - (1142963) | 1142963..1143028 | + | 66 | NuclAT_23 | - | - |
| - (1142963) | 1142963..1143028 | + | 66 | NuclAT_26 | - | - |
| - (1142963) | 1142963..1143028 | + | 66 | NuclAT_26 | - | - |
| - (1142963) | 1142963..1143028 | + | 66 | NuclAT_26 | - | - |
| - (1142963) | 1142963..1143028 | + | 66 | NuclAT_26 | - | - |
| - (1142963) | 1142963..1143028 | + | 66 | NuclAT_29 | - | - |
| - (1142963) | 1142963..1143028 | + | 66 | NuclAT_29 | - | - |
| - (1142963) | 1142963..1143028 | + | 66 | NuclAT_29 | - | - |
| - (1142963) | 1142963..1143028 | + | 66 | NuclAT_29 | - | - |
| - (1142963) | 1142963..1143028 | + | 66 | NuclAT_32 | - | - |
| - (1142963) | 1142963..1143028 | + | 66 | NuclAT_32 | - | - |
| - (1142963) | 1142963..1143028 | + | 66 | NuclAT_32 | - | - |
| - (1142963) | 1142963..1143028 | + | 66 | NuclAT_32 | - | - |
| NR350_RS05535 (1143341) | 1143341..1143448 | - | 108 | WP_000170963.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (1143497) | 1143497..1143562 | + | 66 | NuclAT_34 | - | - |
| - (1143497) | 1143497..1143562 | + | 66 | NuclAT_34 | - | - |
| - (1143497) | 1143497..1143562 | + | 66 | NuclAT_34 | - | - |
| - (1143497) | 1143497..1143562 | + | 66 | NuclAT_34 | - | - |
| - (1143497) | 1143497..1143562 | + | 66 | NuclAT_36 | - | - |
| - (1143497) | 1143497..1143562 | + | 66 | NuclAT_36 | - | - |
| - (1143497) | 1143497..1143562 | + | 66 | NuclAT_36 | - | - |
| - (1143497) | 1143497..1143562 | + | 66 | NuclAT_36 | - | - |
| - (1143497) | 1143497..1143562 | + | 66 | NuclAT_38 | - | - |
| - (1143497) | 1143497..1143562 | + | 66 | NuclAT_38 | - | - |
| - (1143497) | 1143497..1143562 | + | 66 | NuclAT_38 | - | - |
| - (1143497) | 1143497..1143562 | + | 66 | NuclAT_38 | - | - |
| - (1143497) | 1143497..1143562 | + | 66 | NuclAT_40 | - | - |
| - (1143497) | 1143497..1143562 | + | 66 | NuclAT_40 | - | - |
| - (1143497) | 1143497..1143562 | + | 66 | NuclAT_40 | - | - |
| - (1143497) | 1143497..1143562 | + | 66 | NuclAT_40 | - | - |
| - (1143497) | 1143497..1143562 | + | 66 | NuclAT_42 | - | - |
| - (1143497) | 1143497..1143562 | + | 66 | NuclAT_42 | - | - |
| - (1143497) | 1143497..1143562 | + | 66 | NuclAT_42 | - | - |
| - (1143497) | 1143497..1143562 | + | 66 | NuclAT_42 | - | - |
| - (1143497) | 1143497..1143562 | + | 66 | NuclAT_44 | - | - |
| - (1143497) | 1143497..1143562 | + | 66 | NuclAT_44 | - | - |
| - (1143497) | 1143497..1143562 | + | 66 | NuclAT_44 | - | - |
| - (1143497) | 1143497..1143562 | + | 66 | NuclAT_44 | - | - |
| - (1143496) | 1143496..1143563 | + | 68 | NuclAT_16 | - | Antitoxin |
| - (1143496) | 1143496..1143563 | + | 68 | NuclAT_16 | - | Antitoxin |
| - (1143496) | 1143496..1143563 | + | 68 | NuclAT_16 | - | Antitoxin |
| - (1143496) | 1143496..1143563 | + | 68 | NuclAT_16 | - | Antitoxin |
| - (1143496) | 1143496..1143563 | + | 68 | NuclAT_19 | - | Antitoxin |
| - (1143496) | 1143496..1143563 | + | 68 | NuclAT_19 | - | Antitoxin |
| - (1143496) | 1143496..1143563 | + | 68 | NuclAT_19 | - | Antitoxin |
| - (1143496) | 1143496..1143563 | + | 68 | NuclAT_19 | - | Antitoxin |
| - (1143496) | 1143496..1143563 | + | 68 | NuclAT_22 | - | Antitoxin |
| - (1143496) | 1143496..1143563 | + | 68 | NuclAT_22 | - | Antitoxin |
| - (1143496) | 1143496..1143563 | + | 68 | NuclAT_22 | - | Antitoxin |
| - (1143496) | 1143496..1143563 | + | 68 | NuclAT_22 | - | Antitoxin |
| - (1143496) | 1143496..1143563 | + | 68 | NuclAT_25 | - | Antitoxin |
| - (1143496) | 1143496..1143563 | + | 68 | NuclAT_25 | - | Antitoxin |
| - (1143496) | 1143496..1143563 | + | 68 | NuclAT_25 | - | Antitoxin |
| - (1143496) | 1143496..1143563 | + | 68 | NuclAT_25 | - | Antitoxin |
| - (1143496) | 1143496..1143563 | + | 68 | NuclAT_28 | - | Antitoxin |
| - (1143496) | 1143496..1143563 | + | 68 | NuclAT_28 | - | Antitoxin |
| - (1143496) | 1143496..1143563 | + | 68 | NuclAT_28 | - | Antitoxin |
| - (1143496) | 1143496..1143563 | + | 68 | NuclAT_28 | - | Antitoxin |
| - (1143496) | 1143496..1143563 | + | 68 | NuclAT_31 | - | Antitoxin |
| - (1143496) | 1143496..1143563 | + | 68 | NuclAT_31 | - | Antitoxin |
| - (1143496) | 1143496..1143563 | + | 68 | NuclAT_31 | - | Antitoxin |
| - (1143496) | 1143496..1143563 | + | 68 | NuclAT_31 | - | Antitoxin |
| NR350_RS05540 (1143876) | 1143876..1143983 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1144031) | 1144031..1144098 | + | 68 | NuclAT_15 | - | - |
| - (1144031) | 1144031..1144098 | + | 68 | NuclAT_15 | - | - |
| - (1144031) | 1144031..1144098 | + | 68 | NuclAT_15 | - | - |
| - (1144031) | 1144031..1144098 | + | 68 | NuclAT_15 | - | - |
| - (1144031) | 1144031..1144098 | + | 68 | NuclAT_18 | - | - |
| - (1144031) | 1144031..1144098 | + | 68 | NuclAT_18 | - | - |
| - (1144031) | 1144031..1144098 | + | 68 | NuclAT_18 | - | - |
| - (1144031) | 1144031..1144098 | + | 68 | NuclAT_18 | - | - |
| - (1144031) | 1144031..1144098 | + | 68 | NuclAT_21 | - | - |
| - (1144031) | 1144031..1144098 | + | 68 | NuclAT_21 | - | - |
| - (1144031) | 1144031..1144098 | + | 68 | NuclAT_21 | - | - |
| - (1144031) | 1144031..1144098 | + | 68 | NuclAT_21 | - | - |
| - (1144031) | 1144031..1144098 | + | 68 | NuclAT_24 | - | - |
| - (1144031) | 1144031..1144098 | + | 68 | NuclAT_24 | - | - |
| - (1144031) | 1144031..1144098 | + | 68 | NuclAT_24 | - | - |
| - (1144031) | 1144031..1144098 | + | 68 | NuclAT_24 | - | - |
| - (1144031) | 1144031..1144098 | + | 68 | NuclAT_27 | - | - |
| - (1144031) | 1144031..1144098 | + | 68 | NuclAT_27 | - | - |
| - (1144031) | 1144031..1144098 | + | 68 | NuclAT_27 | - | - |
| - (1144031) | 1144031..1144098 | + | 68 | NuclAT_27 | - | - |
| - (1144031) | 1144031..1144098 | + | 68 | NuclAT_30 | - | - |
| - (1144031) | 1144031..1144098 | + | 68 | NuclAT_30 | - | - |
| - (1144031) | 1144031..1144098 | + | 68 | NuclAT_30 | - | - |
| - (1144031) | 1144031..1144098 | + | 68 | NuclAT_30 | - | - |
| NR350_RS05545 (1144387) | 1144387..1145487 | - | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
| NR350_RS05550 (1145757) | 1145757..1145987 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| NR350_RS05555 (1146145) | 1146145..1146840 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| NR350_RS05560 (1146884) | 1146884..1147237 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T253530 WP_000170963.1 NZ_CP102379:c1143448-1143341 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 68 bp
>AT253530 NZ_CP102379:1143496-1143563 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
