Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1894595..1895214 | Replicon | chromosome |
| Accession | NZ_CP102374 | ||
| Organism | Pseudomonas sp. T8 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NRG23_RS08255 | Protein ID | WP_124301294.1 |
| Coordinates | 1894595..1894777 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NRG23_RS08260 | Protein ID | WP_092418556.1 |
| Coordinates | 1894813..1895214 (+) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NRG23_RS08240 (NRG23_08240) | 1892728..1893282 | + | 555 | WP_257374342.1 | hypothetical protein | - |
| NRG23_RS08245 (NRG23_08245) | 1893267..1893623 | + | 357 | WP_257374343.1 | hypothetical protein | - |
| NRG23_RS08250 (NRG23_08250) | 1894024..1894305 | + | 282 | WP_257374344.1 | hypothetical protein | - |
| NRG23_RS08255 (NRG23_08255) | 1894595..1894777 | + | 183 | WP_124301294.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NRG23_RS08260 (NRG23_08260) | 1894813..1895214 | + | 402 | WP_092418556.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NRG23_RS08265 (NRG23_08265) | 1896091..1896855 | - | 765 | WP_257374345.1 | hypothetical protein | - |
| NRG23_RS08270 (NRG23_08270) | 1896949..1897584 | - | 636 | WP_124301293.1 | response regulator transcription factor | - |
| NRG23_RS08275 (NRG23_08275) | 1897581..1899470 | - | 1890 | WP_257374346.1 | PAS domain S-box protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1880081..1903171 | 23090 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6827.99 Da Isoelectric Point: 11.1724
>T253483 WP_124301294.1 NZ_CP102374:1894595-1894777 [Pseudomonas sp. T8]
VQSRQLIKELEAAGWVLERVTGSHHLFKHPYRPETVPVPHPRKDLPRGTVRAIQKLAGLI
VQSRQLIKELEAAGWVLERVTGSHHLFKHPYRPETVPVPHPRKDLPRGTVRAIQKLAGLI
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14588.55 Da Isoelectric Point: 4.7465
>AT253483 WP_092418556.1 NZ_CP102374:1894813-1895214 [Pseudomonas sp. T8]
VHYPICIEWGDEHTATGIQIPDIPGAVTAGDTFEAAYSAAIEIAHVMLEELAREGQAIPLPSPTGTHRANPDFEGMGWGM
LDIDITPYLGKTEKVNVTLPGYVIQRIDRFVREHNIKSRSSFLADAAMEKLGR
VHYPICIEWGDEHTATGIQIPDIPGAVTAGDTFEAAYSAAIEIAHVMLEELAREGQAIPLPSPTGTHRANPDFEGMGWGM
LDIDITPYLGKTEKVNVTLPGYVIQRIDRFVREHNIKSRSSFLADAAMEKLGR
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|