Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 147560..147981 | Replicon | plasmid p170Kb |
| Accession | NZ_CP102245 | ||
| Organism | Escherichia coli O7:H15 strain ST70 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | NQZ80_RS24765 | Protein ID | WP_096937776.1 |
| Coordinates | 147560..147685 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 147783..147981 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQZ80_RS24730 (142956) | 142956..143645 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| NQZ80_RS24735 (143832) | 143832..144215 | - | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| NQZ80_RS24740 (144566) | 144566..145138 | + | 573 | WP_153872885.1 | transglycosylase SLT domain-containing protein | - |
| NQZ80_RS24745 (145434) | 145434..146255 | - | 822 | WP_021541626.1 | DUF932 domain-containing protein | - |
| NQZ80_RS24750 (146374) | 146374..146661 | - | 288 | WP_021541627.1 | hypothetical protein | - |
| NQZ80_RS24755 (146686) | 146686..146892 | - | 207 | WP_000275848.1 | hypothetical protein | - |
| NQZ80_RS24760 (146962) | 146962..147259 | + | 298 | Protein_138 | hypothetical protein | - |
| NQZ80_RS24765 (147560) | 147560..147685 | - | 126 | WP_096937776.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| NQZ80_RS24770 (147627) | 147627..147776 | - | 150 | Protein_140 | DUF5431 family protein | - |
| - (147783) | 147783..147981 | - | 199 | NuclAT_0 | - | Antitoxin |
| - (147783) | 147783..147981 | - | 199 | NuclAT_0 | - | Antitoxin |
| - (147783) | 147783..147981 | - | 199 | NuclAT_0 | - | Antitoxin |
| - (147783) | 147783..147981 | - | 199 | NuclAT_0 | - | Antitoxin |
| NQZ80_RS24775 (147950) | 147950..148712 | - | 763 | Protein_141 | plasmid SOS inhibition protein A | - |
| NQZ80_RS24780 (148709) | 148709..149143 | - | 435 | WP_021541629.1 | conjugation system SOS inhibitor PsiB | - |
| NQZ80_RS24785 (149208) | 149208..151157 | - | 1950 | WP_021541630.1 | ParB/RepB/Spo0J family partition protein | - |
| NQZ80_RS24790 (151221) | 151221..151454 | - | 234 | WP_000005988.1 | DUF905 family protein | - |
| NQZ80_RS24795 (151511) | 151511..152050 | - | 540 | WP_021541631.1 | single-stranded DNA-binding protein | - |
| NQZ80_RS24800 (152076) | 152076..152282 | - | 207 | WP_000547955.1 | hypothetical protein | - |
| NQZ80_RS24805 (152352) | 152352..152772 | + | 421 | Protein_147 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | papC / papD / hlyB / iroB / iroC / iroD / iroE / iroN / faeJ / faeI / faeH / faeF / faeE / faeD / faeC | 1..170322 | 170322 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4806.72 Da Isoelectric Point: 8.4890
>T253376 WP_096937776.1 NZ_CP102245:c147685-147560 [Escherichia coli O7:H15]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 199 bp
>AT253376 NZ_CP102245:c147981-147783 [Escherichia coli O7:H15]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|