Detailed information of TA system TA253376

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 147560..147981
• Replicon: plasmid p170Kb
• Accession: NZ_CP102245
• Organism: Escherichia coli O7:H15 strain ST70

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NQZ80_RS24765
• Protein ID: WP_096937776.1
• Coordinates: 147560..147685 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	147783..147981 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NQZ80_RS24730 (142956)	142956..143645	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
NQZ80_RS24735 (143832)	143832..144215	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NQZ80_RS24740 (144566)	144566..145138	+	573	WP_153872885.1	transglycosylase SLT domain-containing protein	-
NQZ80_RS24745 (145434)	145434..146255	-	822	WP_021541626.1	DUF932 domain-containing protein	-
NQZ80_RS24750 (146374)	146374..146661	-	288	WP_021541627.1	hypothetical protein	-
NQZ80_RS24755 (146686)	146686..146892	-	207	WP_000275848.1	hypothetical protein	-
NQZ80_RS24760 (146962)	146962..147259	+	298	Protein_138	hypothetical protein	-
NQZ80_RS24765 (147560)	147560..147685	-	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
NQZ80_RS24770 (147627)	147627..147776	-	150	Protein_140	DUF5431 family protein	-
- (147783)	147783..147981	-	199	NuclAT_0	-	Antitoxin
- (147783)	147783..147981	-	199	NuclAT_0	-	Antitoxin
- (147783)	147783..147981	-	199	NuclAT_0	-	Antitoxin
- (147783)	147783..147981	-	199	NuclAT_0	-	Antitoxin
NQZ80_RS24775 (147950)	147950..148712	-	763	Protein_141	plasmid SOS inhibition protein A	-
NQZ80_RS24780 (148709)	148709..149143	-	435	WP_021541629.1	conjugation system SOS inhibitor PsiB	-
NQZ80_RS24785 (149208)	149208..151157	-	1950	WP_021541630.1	ParB/RepB/Spo0J family partition protein	-
NQZ80_RS24790 (151221)	151221..151454	-	234	WP_000005988.1	DUF905 family protein	-
NQZ80_RS24795 (151511)	151511..152050	-	540	WP_021541631.1	single-stranded DNA-binding protein	-
NQZ80_RS24800 (152076)	152076..152282	-	207	WP_000547955.1	hypothetical protein	-
NQZ80_RS24805 (152352)	152352..152772	+	421	Protein_147	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	papC / papD / hlyB / iroB / iroC / iroD / iroE / iroN / faeJ / faeI / faeH / faeF / faeE / faeD / faeC	1..170322	170322

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T253376 WP_096937776.1 NZ_CP102245:c147685-147560 [Escherichia coli O7:H15]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 199 bp

>AT253376 NZ_CP102245:c147981-147783 [Escherichia coli O7:H15]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC

Structures

Antitoxin