Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 110118..110372 Replicon plasmid p170Kb
Accession NZ_CP102245
Organism Escherichia coli O7:H15 strain ST70

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag NQZ80_RS24540 Protein ID WP_001312851.1
Coordinates 110118..110267 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 110311..110372 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQZ80_RS24530 (106671) 106671..107207 - 537 WP_050576079.1 type 1 fimbrial protein -
NQZ80_RS24535 (109355) 109355..109864 - 510 Protein_93 plasmid replication initiator RepA -
NQZ80_RS24540 (110118) 110118..110267 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (110311) 110311..110372 + 62 NuclAT_1 - Antitoxin
- (110311) 110311..110372 + 62 NuclAT_1 - Antitoxin
- (110311) 110311..110372 + 62 NuclAT_1 - Antitoxin
- (110311) 110311..110372 + 62 NuclAT_1 - Antitoxin
NQZ80_RS24545 (110628) 110628..110702 - 75 Protein_95 endonuclease -
NQZ80_RS24550 (110948) 110948..111160 - 213 WP_001299730.1 ANR family transcriptional regulator -
NQZ80_RS24555 (111296) 111296..111856 - 561 WP_021541609.1 fertility inhibition protein FinO -
NQZ80_RS24560 (111911) 111911..112657 - 747 WP_000205759.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - papC / papD / hlyB / iroB / iroC / iroD / iroE / iroN / faeJ / faeI / faeH / faeF / faeE / faeD / faeC 1..170322 170322


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T253374 WP_001312851.1 NZ_CP102245:c110267-110118 [Escherichia coli O7:H15]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 62 bp

>AT253374 NZ_CP102245:110311-110372 [Escherichia coli O7:H15]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References