Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-PHD |
Location | 3813929..3814596 | Replicon | chromosome |
Accession | NZ_CP101989 | ||
Organism | Cellulomonas wangsupingiae strain zg-Y908 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NP075_RS17525 | Protein ID | WP_227563378.1 |
Coordinates | 3813929..3814321 (-) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NP075_RS17530 | Protein ID | WP_227563379.1 |
Coordinates | 3814324..3814596 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP075_RS17505 (NP075_17505) | 3809450..3810197 | - | 748 | Protein_3438 | SDR family oxidoreductase | - |
NP075_RS17510 (NP075_17510) | 3810631..3812061 | - | 1431 | WP_227563375.1 | ADP-ribosylglycohydrolase family protein | - |
NP075_RS17515 (NP075_17515) | 3812411..3812974 | + | 564 | WP_227563376.1 | DUF6318 family protein | - |
NP075_RS17520 (NP075_17520) | 3812971..3813867 | + | 897 | WP_227563377.1 | PKD domain-containing protein | - |
NP075_RS17525 (NP075_17525) | 3813929..3814321 | - | 393 | WP_227563378.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NP075_RS17530 (NP075_17530) | 3814324..3814596 | - | 273 | WP_227563379.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
NP075_RS17535 (NP075_17535) | 3814708..3814887 | - | 180 | WP_227563380.1 | hypothetical protein | - |
NP075_RS17540 (NP075_17540) | 3814986..3815429 | - | 444 | WP_227563381.1 | hypothetical protein | - |
NP075_RS17545 (NP075_17545) | 3815810..3816079 | - | 270 | WP_227563382.1 | alpha-mannosidase | - |
NP075_RS17550 (NP075_17550) | 3816110..3816718 | - | 609 | WP_227563383.1 | hypothetical protein | - |
NP075_RS17555 (NP075_17555) | 3816832..3819147 | - | 2316 | WP_256791285.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3783463..3816835 | 33372 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 13805.79 Da Isoelectric Point: 4.4687
>T253072 WP_227563378.1 NZ_CP101989:c3814321-3813929 [Cellulomonas wangsupingiae]
VAYYLDTSALVKLVVEEAETPALREWWRSHGTTPVACDLVRTELMRAVRRAAPEAAVQAHAVLDGLVLLSVTSRVCDAAG
RLEPATLRSLDAIHLAAALELGDDLEGIVTYDDRLAEAAVAYGVAVVAPA
VAYYLDTSALVKLVVEEAETPALREWWRSHGTTPVACDLVRTELMRAVRRAAPEAAVQAHAVLDGLVLLSVTSRVCDAAG
RLEPATLRSLDAIHLAAALELGDDLEGIVTYDDRLAEAAVAYGVAVVAPA
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|