Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1874277..1875112 | Replicon | chromosome |
| Accession | NZ_CP101921 | ||
| Organism | Escherichia coli strain QA-1986 83 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1U9SHU4 |
| Locus tag | NP438_RS09015 | Protein ID | WP_000854752.1 |
| Coordinates | 1874277..1874654 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | E3PJ72 |
| Locus tag | NP438_RS09020 | Protein ID | WP_001278232.1 |
| Coordinates | 1874744..1875112 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP438_RS08980 (1869797) | 1869797..1870270 | + | 474 | WP_001105384.1 | DNA gyrase inhibitor SbmC | - |
| NP438_RS08985 (1870468) | 1870468..1871526 | + | 1059 | WP_001200892.1 | FUSC family protein | - |
| NP438_RS08990 (1871698) | 1871698..1872027 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| NP438_RS08995 (1872128) | 1872128..1872493 | - | 366 | WP_001282181.1 | EutP/PduV family microcompartment system protein | - |
| NP438_RS09000 (1872764) | 1872764..1873153 | - | 390 | WP_001445118.1 | IS110 family transposase | - |
| NP438_RS09005 (1873951) | 1873951..1874031 | - | 81 | Protein_1761 | hypothetical protein | - |
| NP438_RS09010 (1874131) | 1874131..1874280 | - | 150 | Protein_1762 | DUF5983 family protein | - |
| NP438_RS09015 (1874277) | 1874277..1874654 | - | 378 | WP_000854752.1 | TA system toxin CbtA family protein | Toxin |
| NP438_RS09020 (1874744) | 1874744..1875112 | - | 369 | WP_001278232.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| NP438_RS09025 (1875275) | 1875275..1875496 | - | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| NP438_RS09030 (1875559) | 1875559..1876035 | - | 477 | WP_001347688.1 | RadC family protein | - |
| NP438_RS09035 (1876051) | 1876051..1876536 | - | 486 | WP_000849582.1 | antirestriction protein | - |
| NP438_RS09040 (1876591) | 1876591..1877409 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| NP438_RS09045 (1877509) | 1877509..1877742 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| NP438_RS09050 (1877821) | 1877821..1878276 | - | 456 | WP_000581504.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14076.08 Da Isoelectric Point: 8.2905
>T252950 WP_000854752.1 NZ_CP101921:c1874654-1874277 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13491.37 Da Isoelectric Point: 6.6290
>AT252950 WP_001278232.1 NZ_CP101921:c1875112-1874744 [Escherichia coli]
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1U9SHU4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | E3PJ72 |