Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 607021..607820 | Replicon | chromosome |
| Accession | NZ_CP101920 | ||
| Organism | Escherichia coli strain QA-1986 630 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | U9XVR9 |
| Locus tag | NP447_RS02945 | Protein ID | WP_000347267.1 |
| Coordinates | 607021..607485 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | NP447_RS02950 | Protein ID | WP_001307405.1 |
| Coordinates | 607485..607820 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP447_RS02915 (602022) | 602022..602456 | - | 435 | WP_000948814.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| NP447_RS02920 (602474) | 602474..603352 | - | 879 | WP_001341890.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| NP447_RS02925 (603342) | 603342..604121 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| NP447_RS02930 (604132) | 604132..604605 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| NP447_RS02935 (604628) | 604628..605908 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| NP447_RS02940 (606157) | 606157..606966 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| NP447_RS02945 (607021) | 607021..607485 | - | 465 | WP_000347267.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| NP447_RS02950 (607485) | 607485..607820 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| NP447_RS02955 (607969) | 607969..609540 | - | 1572 | WP_001273741.1 | galactarate dehydratase | - |
| NP447_RS02960 (609915) | 609915..611249 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| NP447_RS02965 (611265) | 611265..612035 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17807.17 Da Isoelectric Point: 9.4947
>T252927 WP_000347267.1 NZ_CP101920:c607485-607021 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XTR4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |