Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1785472..1786307 | Replicon | chromosome |
| Accession | NZ_CP101915 | ||
| Organism | Escherichia coli strain Evo1 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | NP443_RS08505 | Protein ID | WP_042046912.1 |
| Coordinates | 1785472..1785849 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | NP443_RS08510 | Protein ID | WP_074514516.1 |
| Coordinates | 1785939..1786307 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP443_RS08470 (1780992) | 1780992..1781465 | + | 474 | WP_001105407.1 | DNA gyrase inhibitor SbmC | - |
| NP443_RS08475 (1781663) | 1781663..1782721 | + | 1059 | WP_001200895.1 | FUSC family protein | - |
| NP443_RS08480 (1782893) | 1782893..1783222 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| NP443_RS08485 (1783323) | 1783323..1783688 | - | 366 | WP_001280455.1 | EutP/PduV family microcompartment system protein | - |
| NP443_RS08490 (1783959) | 1783959..1784348 | - | 390 | WP_077875581.1 | transposase | - |
| NP443_RS08495 (1785146) | 1785146..1785226 | - | 81 | Protein_1660 | hypothetical protein | - |
| NP443_RS08500 (1785326) | 1785326..1785475 | - | 150 | Protein_1661 | DUF5983 family protein | - |
| NP443_RS08505 (1785472) | 1785472..1785849 | - | 378 | WP_042046912.1 | TA system toxin CbtA family protein | Toxin |
| NP443_RS08510 (1785939) | 1785939..1786307 | - | 369 | WP_074514516.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NP443_RS08515 (1786470) | 1786470..1786691 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| NP443_RS08520 (1786754) | 1786754..1787230 | - | 477 | WP_001186774.1 | RadC family protein | - |
| NP443_RS08525 (1787246) | 1787246..1787719 | - | 474 | WP_000855059.1 | antirestriction protein | - |
| NP443_RS08530 (1788061) | 1788061..1788879 | - | 819 | WP_074527539.1 | DUF932 domain-containing protein | - |
| NP443_RS08535 (1788997) | 1788997..1789192 | - | 196 | Protein_1668 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1779715..1780935 | 1220 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14020.96 Da Isoelectric Point: 7.8276
>T252910 WP_042046912.1 NZ_CP101915:c1785849-1785472 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13550.23 Da Isoelectric Point: 5.8786
>AT252910 WP_074514516.1 NZ_CP101915:c1786307-1785939 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYAYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYAYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|