Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-dinJ/YafQ-RelB |
Location | 1989531..1990062 | Replicon | chromosome |
Accession | NZ_CP101739 | ||
Organism | Stutzerimonas stutzeri strain J15 |
Toxin (Protein)
Gene name | relE | Uniprot ID | W2D823 |
Locus tag | NPN27_RS09420 | Protein ID | WP_011282522.1 |
Coordinates | 1989781..1990062 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | W2D9V6 |
Locus tag | NPN27_RS09415 | Protein ID | WP_020303033.1 |
Coordinates | 1989531..1989794 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPN27_RS09390 (NPN27_09390) | 1984565..1984792 | + | 228 | Protein_1848 | integrase | - |
NPN27_RS09395 (NPN27_09395) | 1984986..1985789 | - | 804 | WP_013983152.1 | IS21-like element ISPst3 family helper ATPase IstB | - |
NPN27_RS09400 (NPN27_09400) | 1985782..1987281 | - | 1500 | WP_256519138.1 | IS21-like element ISPst3 family transposase | - |
NPN27_RS09405 (NPN27_09405) | 1987397..1988731 | - | 1335 | Protein_1851 | IS481 family transposase | - |
NPN27_RS09410 (NPN27_09410) | 1988736..1989311 | - | 576 | WP_032905003.1 | recombinase family protein | - |
NPN27_RS09415 (NPN27_09415) | 1989531..1989794 | + | 264 | WP_020303033.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NPN27_RS09420 (NPN27_09420) | 1989781..1990062 | + | 282 | WP_011282522.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
NPN27_RS09425 (NPN27_09425) | 1990282..1990529 | + | 248 | Protein_1855 | hypothetical protein | - |
NPN27_RS09430 (NPN27_09430) | 1990619..1992244 | - | 1626 | WP_256519045.1 | methyl-accepting chemotaxis protein | - |
NPN27_RS09435 (NPN27_09435) | 1992547..1993404 | - | 858 | WP_057386701.1 | phosphate/phosphite/phosphonate ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1979364..1996427 | 17063 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10710.20 Da Isoelectric Point: 9.6866
>T252583 WP_011282522.1 NZ_CP101739:1989781-1990062 [Stutzerimonas stutzeri]
MRTIEQTSRFKRDYKREAKGPHRQTLASDFIAVVTALANNQPLAEKHRDHALTGDWKDHRDCHIKPDLVLIYRKPDDAVL
QLVRLGSHSELGL
MRTIEQTSRFKRDYKREAKGPHRQTLASDFIAVVTALANNQPLAEKHRDHALTGDWKDHRDCHIKPDLVLIYRKPDDAVL
QLVRLGSHSELGL
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0W0N2T9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0W0N2R7 |