Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 1222771..1223344 Replicon chromosome
Accession NZ_CP101739
Organism Stutzerimonas stutzeri strain J15

Toxin (Protein)


Gene name relE Uniprot ID W5IUR0
Locus tag NPN27_RS05945 Protein ID WP_009618209.1
Coordinates 1223057..1223344 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID W5ISI7
Locus tag NPN27_RS05940 Protein ID WP_009618210.1
Coordinates 1222771..1223070 (+) Length 100 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPN27_RS05910 (NPN27_05910) 1217873..1218091 + 219 WP_011829925.1 AlpA family transcriptional regulator -
NPN27_RS05915 (NPN27_05915) 1218132..1218998 + 867 WP_018076212.1 ParA family protein -
NPN27_RS05920 (NPN27_05920) 1218982..1219218 + 237 WP_013982111.1 type II toxin-antitoxin system HicA family toxin -
NPN27_RS05925 (NPN27_05925) 1219211..1220869 + 1659 WP_256518884.1 ParB family protein -
NPN27_RS05930 (NPN27_05930) 1220887..1221447 + 561 WP_018076214.1 DUF2857 domain-containing protein -
NPN27_RS05935 (NPN27_05935) 1221450..1222643 + 1194 WP_017244810.1 STY4528 family pathogenicity island replication protein -
NPN27_RS05940 (NPN27_05940) 1222771..1223070 + 300 WP_009618210.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
NPN27_RS05945 (NPN27_05945) 1223057..1223344 + 288 WP_009618209.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NPN27_RS05950 (NPN27_05950) 1223373..1223564 + 192 WP_011805449.1 hypothetical protein -
NPN27_RS05955 (NPN27_05955) 1223688..1224467 + 780 WP_017244811.1 TIGR03761 family integrating conjugative element protein -
NPN27_RS05960 (NPN27_05960) 1224464..1225012 + 549 WP_017244812.1 DUF3158 family protein -
NPN27_RS05965 (NPN27_05965) 1225009..1225392 + 384 WP_016852001.1 single-stranded DNA-binding protein -
NPN27_RS05970 (NPN27_05970) 1225687..1227702 + 2016 WP_256518885.1 DNA topoisomerase III -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1213551..1350234 136683


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-90)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(4-58)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10854.46 Da        Isoelectric Point: 8.4628

>T252582 WP_009618209.1 NZ_CP101739:1223057-1223344 [Stutzerimonas stutzeri]
VRVLEWREAARADLLAIVDYISDDNPDAAQRLKDDIEAKAAKLPERPKLYRPGRVAGTREMVVRANYVVVYMEDTRAVSI
LRVLHAAQQWPPARE

Download         Length: 288 bp

Antitoxin


Download         Length: 100 a.a.        Molecular weight: 10816.46 Da        Isoelectric Point: 8.6579

>AT252582 WP_009618210.1 NZ_CP101739:1222771-1223070 [Stutzerimonas stutzeri]
MAAQTSMLHIRVDDKLKADAAEKLAGVGLTVSDAVRILLTRVVKEGALPAGLTADPEAYDAWFRAKVQEALADTRPPVPH
QQVMDEAQALIDRKRRART

Download         Length: 300 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5R9QF16

Antitoxin

Source ID Structure
AlphaFold DB A0A5R9QE11

References