Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 44864..45399 Replicon plasmid pM171-1.1
Accession NZ_CP101667
Organism Escherichia coli strain M171-1

Toxin (Protein)


Gene name relE Uniprot ID Q3YTD6
Locus tag NO473_RS22495 Protein ID WP_000222766.1
Coordinates 45112..45399 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0VIP2
Locus tag NO473_RS22490 Protein ID WP_001132900.1
Coordinates 44864..45115 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NO473_RS22455 (39916) 39916..40659 + 744 WP_039002216.1 conjugal transfer pilus acetylase TraX -
NO473_RS22460 (40714) 40714..41274 + 561 WP_000139310.1 fertility inhibition protein FinO -
NO473_RS22465 (41409) 41409..41621 + 213 WP_001541896.1 ANR family transcriptional regulator -
- (41963) 41963..42024 - 62 NuclAT_1 - -
- (41963) 41963..42024 - 62 NuclAT_1 - -
- (41963) 41963..42024 - 62 NuclAT_1 - -
- (41963) 41963..42024 - 62 NuclAT_1 - -
NO473_RS22470 (42068) 42068..42217 + 150 WP_001312851.1 Hok/Gef family protein -
NO473_RS22475 (42485) 42485..42742 + 258 WP_001541895.1 replication regulatory protein RepA -
NO473_RS22480 (42974) 42974..43048 + 75 WP_061357229.1 RepA leader peptide Tap -
NO473_RS22485 (43041) 43041..43898 + 858 WP_039002220.1 incFII family plasmid replication initiator RepA -
NO473_RS22490 (44864) 44864..45115 + 252 WP_001132900.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NO473_RS22495 (45112) 45112..45399 + 288 WP_000222766.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NO473_RS22500 (45474) 45474..45662 - 189 Protein_56 IS3 family transposase -
NO473_RS22505 (45696) 45696..46196 - 501 Protein_57 Tn3 family transposase -
NO473_RS22510 (46230) 46230..49234 - 3005 Protein_58 Tn3-like element Tn3 family transposase -
NO473_RS22515 (49398) 49398..49955 + 558 WP_001235713.1 recombinase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / sul3 / aph(3')-Ia / sul2 / floR / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / tet(M) - 1..122198 122198


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11147.23 Da        Isoelectric Point: 10.5832

>T252481 WP_000222766.1 NZ_CP101667:45112-45399 [Escherichia coli]
MTYTVKFRDDALKEWLKLDKTIQQQFVKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9211.41 Da        Isoelectric Point: 4.0780

>AT252481 WP_001132900.1 NZ_CP101667:44864-45115 [Escherichia coli]
MPNIILSDTSASVSELKKNPMATVSAGDGYPVAILNRNQPAFYCVPAELYERMLDALDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CDZ2

Antitoxin

Source ID Structure
AlphaFold DB V0VIP2

References