Detailed information of TA system TA252476

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 6642..6911
• Replicon: plasmid pM171-1.1
• Accession: NZ_CP101667
• Organism: Escherichia coli strain M171-1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NO473_RS22275
• Protein ID: WP_001372321.1
• Coordinates: 6786..6911 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	6642..6707 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NO473_RS22230	1716..1943	+	228	WP_071961421.1	hypothetical protein	-
NO473_RS22235	2184..2390	+	207	WP_000275853.1	hypothetical protein	-
NO473_RS22240	2416..2955	+	540	WP_032332913.1	single-stranded DNA-binding protein	-
NO473_RS22245	3012..3245	+	234	WP_000005987.1	DUF905 family protein	-
NO473_RS22250	3310..5268	+	1959	WP_039000998.1	ParB/RepB/Spo0J family partition protein	-
NO473_RS22255	5323..5757	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
NO473_RS22260	5754..6516	+	763	Protein_8	plasmid SOS inhibition protein A	-
NO473_RS22265	6485..6673	-	189	WP_001299721.1	hypothetical protein	-
-	6485..6709	+	225	NuclAT_0	-	-
-	6485..6709	+	225	NuclAT_0	-	-
-	6485..6709	+	225	NuclAT_0	-	-
-	6485..6709	+	225	NuclAT_0	-	-
-	6642..6707	-	66	-	-	Antitoxin
NO473_RS22270	6695..6844	+	150	Protein_10	plasmid maintenance protein Mok	-
NO473_RS22275	6786..6911	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NO473_RS22280	7131..7361	+	231	WP_001426396.1	hypothetical protein	-
NO473_RS22285	7359..7532	-	174	Protein_13	hypothetical protein	-
NO473_RS22290	7602..7808	+	207	WP_000547968.1	hypothetical protein	-
NO473_RS22295	7833..8120	+	288	WP_000107535.1	hypothetical protein	-
NO473_RS22300	8242..9063	+	822	WP_072795862.1	DUF932 domain-containing protein	-
NO473_RS22305	9360..9962	-	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
NO473_RS22310	10281..10664	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NO473_RS22315	10851..11540	+	690	WP_039002187.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaTEM-1B / sul3 / aph(3')-Ia / sul2 / floR / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / tet(M)	-	1..122198	122198

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T252476 WP_001372321.1 NZ_CP101667:6786-6911 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT252476 NZ_CP101667:c6707-6642 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin