Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 3057266..3057878 | Replicon | chromosome |
| Accession | NZ_CP101666 | ||
| Organism | Escherichia coli strain M171-1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | U9YXE2 |
| Locus tag | NO473_RS14870 | Protein ID | WP_000833473.1 |
| Coordinates | 3057266..3057451 (+) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A5F1W1Z0 |
| Locus tag | NO473_RS14875 | Protein ID | WP_000499743.1 |
| Coordinates | 3057468..3057878 (+) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NO473_RS14855 (3053001) | 3053001..3053969 | + | 969 | Protein_2884 | L-threonine dehydrogenase | - |
| NO473_RS14860 (3054134) | 3054134..3055672 | + | 1539 | WP_001359414.1 | aldehyde dehydrogenase AldB | - |
| NO473_RS14865 (3055713) | 3055713..3056792 | - | 1080 | WP_170854857.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
| NO473_RS14870 (3057266) | 3057266..3057451 | + | 186 | WP_000833473.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NO473_RS14875 (3057468) | 3057468..3057878 | + | 411 | WP_000499743.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NO473_RS14880 (3057950) | 3057950..3059914 | - | 1965 | WP_040062336.1 | glycoside hydrolase family 127 protein | - |
| NO473_RS14885 (3059925) | 3059925..3061325 | - | 1401 | WP_000204832.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 3051942..3052865 | 923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6800.89 Da Isoelectric Point: 11.7053
>T252469 WP_000833473.1 NZ_CP101666:3057266-3057451 [Escherichia coli]
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15213.09 Da Isoelectric Point: 4.5486
>AT252469 WP_000499743.1 NZ_CP101666:3057468-3057878 [Escherichia coli]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGA
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGA
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | U9YXE2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5F1W1Z0 |