Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 8187..8788 Replicon plasmid pDC71-3
Accession NZ_CP101618
Organism Escherichia coli strain DC71

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag NOF56_RS23960 Protein ID WP_001216034.1
Coordinates 8187..8567 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag NOF56_RS23965 Protein ID WP_001190712.1
Coordinates 8567..8788 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NOF56_RS23920 (3567) 3567..3835 + 269 Protein_6 type II toxin-antitoxin system ParD family antitoxin -
NOF56_RS23925 (3822) 3822..4111 + 290 Protein_7 type II toxin-antitoxin system RelE/ParE family toxin -
NOF56_RS23930 (4178) 4178..4360 + 183 WP_042065278.1 hypothetical protein -
NOF56_RS23935 (4481) 4481..5221 + 741 WP_001066942.1 tyrosine-type recombinase/integrase -
NOF56_RS23940 (5506) 5506..6483 - 978 WP_000361610.1 RepB family plasmid replication initiator protein -
NOF56_RS23945 (7279) 7279..7692 - 414 Protein_11 integrase core domain-containing protein -
NOF56_RS23950 (7697) 7697..7975 - 279 Protein_12 pdcB -
NOF56_RS23955 (8003) 8003..8182 - 180 WP_001513661.1 hypothetical protein -
NOF56_RS23960 (8187) 8187..8567 - 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NOF56_RS23965 (8567) 8567..8788 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NOF56_RS23970 (8971) 8971..10527 + 1557 WP_001553856.1 type I restriction-modification system subunit M -
NOF56_RS23975 (10524) 10524..11807 + 1284 WP_001617890.1 restriction endonuclease subunit S -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mph(A) / aadA5 / sul1 / tet(B) - 1..72929 72929
- flank IS/Tn - - 7279..7653 374


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T252399 WP_001216034.1 NZ_CP101618:c8567-8187 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT252399 WP_001190712.1 NZ_CP101618:c8788-8567 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References