Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeV-yfjZ/CbtA-CbeA |
| Location | 3729360..3730083 | Replicon | chromosome |
| Accession | NZ_CP101595 | ||
| Organism | Cronobacter dublinensis strain CFSA A84 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | NNQ27_RS17960 | Protein ID | WP_275885108.1 |
| Coordinates | 3729360..3729680 (-) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | NNQ27_RS17965 | Protein ID | WP_275885109.1 |
| Coordinates | 3729748..3730083 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NNQ27_RS17935 (NNQ27_17935) | 3725040..3726884 | + | 1845 | WP_007727072.1 | RNA polymerase sigma factor RpoD | - |
| NNQ27_RS17940 (NNQ27_17940) | 3727136..3727555 | + | 420 | WP_275885106.1 | hypothetical protein | - |
| NNQ27_RS17945 (NNQ27_17945) | 3727602..3728108 | - | 507 | WP_007752318.1 | G/U mismatch-specific DNA glycosylase | - |
| NNQ27_RS17955 (NNQ27_17955) | 3728413..3729246 | - | 834 | WP_275885107.1 | DUF4942 domain-containing protein | - |
| NNQ27_RS17960 (NNQ27_17960) | 3729360..3729680 | - | 321 | WP_275885108.1 | TA system toxin CbtA family protein | Toxin |
| NNQ27_RS17965 (NNQ27_17965) | 3729748..3730083 | - | 336 | WP_275885109.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NNQ27_RS17970 (NNQ27_17970) | 3730098..3730577 | - | 480 | WP_275885110.1 | DNA repair protein RadC | - |
| NNQ27_RS17975 (NNQ27_17975) | 3730950..3731087 | - | 138 | Protein_3503 | transposase | - |
| NNQ27_RS17980 (NNQ27_17980) | 3731237..3732364 | + | 1128 | WP_275885111.1 | ATP-binding protein | - |
| NNQ27_RS17985 (NNQ27_17985) | 3732369..3732917 | + | 549 | WP_059384886.1 | helix-turn-helix domain-containing protein | - |
| NNQ27_RS17990 (NNQ27_17990) | 3733054..3734145 | + | 1092 | WP_275885112.1 | multiubiquitin domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3728413..3760599 | 32186 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12070.72 Da Isoelectric Point: 5.0359
>T252368 WP_275885108.1 NZ_CP101595:c3729680-3729360 [Cronobacter dublinensis]
MQISTVPATLPVSSRLSPVQVWQQLLTYLLEQHYGLTLNDTPFHEDAAIQEHIEAGITLADAVNFLVERYELVRTDRKGF
TWQEQTPFLTATDILRARRATGLMNT
MQISTVPATLPVSSRLSPVQVWQQLLTYLLEQHYGLTLNDTPFHEDAAIQEHIEAGITLADAVNFLVERYELVRTDRKGF
TWQEQTPFLTATDILRARRATGLMNT
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|