Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 2951027..2951672 | Replicon | chromosome |
| Accession | NZ_CP101595 | ||
| Organism | Cronobacter dublinensis strain CFSA A84 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NNQ27_RS14285 | Protein ID | WP_275884859.1 |
| Coordinates | 2951310..2951672 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NNQ27_RS14280 | Protein ID | WP_007750247.1 |
| Coordinates | 2951027..2951323 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NNQ27_RS14270 (NNQ27_14280) | 2948685..2949533 | - | 849 | WP_275884857.1 | DNA-3-methyladenine glycosylase 2 | - |
| NNQ27_RS14275 (NNQ27_14285) | 2949669..2951021 | + | 1353 | WP_275884858.1 | molecular chaperone | - |
| NNQ27_RS14280 (NNQ27_14290) | 2951027..2951323 | - | 297 | WP_007750247.1 | XRE family transcriptional regulator | Antitoxin |
| NNQ27_RS14285 (NNQ27_14295) | 2951310..2951672 | - | 363 | WP_275884859.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NNQ27_RS14290 (NNQ27_14300) | 2951902..2953143 | + | 1242 | WP_105636316.1 | MdtA/MuxA family multidrug efflux RND transporter periplasmic adaptor subunit | - |
| NNQ27_RS14295 (NNQ27_14305) | 2953143..2956265 | + | 3123 | WP_275884860.1 | MdtB/MuxB family multidrug efflux RND transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 14009.10 Da Isoelectric Point: 9.8453
>T252366 WP_275884859.1 NZ_CP101595:c2951672-2951310 [Cronobacter dublinensis]
MTWTVIFTPRFYEWYQQQPEGLQDRIAALLWNLRHSGPLVGRPLVDTIKGSQIPNLKELRVQYGGSPWRVFFAFDPTRQA
VVLCAGNKRGHKDFYKTLIRQAEDAFFLHLQIMESKNENA
MTWTVIFTPRFYEWYQQQPEGLQDRIAALLWNLRHSGPLVGRPLVDTIKGSQIPNLKELRVQYGGSPWRVFFAFDPTRQA
VVLCAGNKRGHKDFYKTLIRQAEDAFFLHLQIMESKNENA
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|