Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5397031..5397656 | Replicon | chromosome |
| Accession | NZ_CP101542 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain KP21 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | R4Y4A3 |
| Locus tag | NMY29_RS26660 | Protein ID | WP_002882817.1 |
| Coordinates | 5397031..5397414 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | NMY29_RS26665 | Protein ID | WP_004150355.1 |
| Coordinates | 5397414..5397656 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMY29_RS26645 (NMY29_26625) | 5394397..5395299 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| NMY29_RS26650 (NMY29_26630) | 5395296..5395931 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NMY29_RS26655 (NMY29_26635) | 5395928..5396857 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| NMY29_RS26660 (NMY29_26640) | 5397031..5397414 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NMY29_RS26665 (NMY29_26645) | 5397414..5397656 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| NMY29_RS26670 (NMY29_26650) | 5397861..5398778 | + | 918 | WP_002882812.1 | alpha/beta hydrolase | - |
| NMY29_RS26675 (NMY29_26655) | 5398792..5399733 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| NMY29_RS26680 (NMY29_26660) | 5399778..5400215 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| NMY29_RS26685 (NMY29_26665) | 5400212..5401072 | - | 861 | WP_002882807.1 | virulence factor BrkB family protein | - |
| NMY29_RS26690 (NMY29_26670) | 5401066..5401665 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T252250 WP_002882817.1 NZ_CP101542:c5397414-5397031 [Klebsiella pneumoniae subsp. pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GPK8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |