Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 205853..206523 | Replicon | plasmid pB |
Accession | NZ_CP101519 | ||
Organism | Ensifer adhaerens strain NER9 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | MYG64_RS28920 | Protein ID | WP_127890236.1 |
Coordinates | 206104..206523 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | MYG64_RS28915 | Protein ID | WP_060529947.1 |
Coordinates | 205853..206107 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MYG64_RS28890 (MYG64_28780) | 200903..201844 | + | 942 | WP_112975005.1 | glyoxylate/hydroxypyruvate reductase A | - |
MYG64_RS28895 (MYG64_28785) | 201920..203530 | + | 1611 | WP_060529950.1 | peptide ABC transporter substrate-binding protein | - |
MYG64_RS28900 (MYG64_28790) | 203593..204546 | + | 954 | WP_060529949.1 | ABC transporter permease | - |
MYG64_RS28905 (MYG64_28795) | 204539..205420 | + | 882 | WP_255382003.1 | ABC transporter permease | - |
MYG64_RS28910 (MYG64_28800) | 205552..205801 | + | 250 | Protein_187 | type II toxin-antitoxin system RelE/ParE family toxin | - |
MYG64_RS28915 (MYG64_28805) | 205853..206107 | + | 255 | WP_060529947.1 | hypothetical protein | Antitoxin |
MYG64_RS28920 (MYG64_28810) | 206104..206523 | + | 420 | WP_127890236.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MYG64_RS28925 (MYG64_28815) | 206722..207057 | + | 336 | WP_113188403.1 | hypothetical protein | - |
MYG64_RS28930 (MYG64_28820) | 207362..208189 | + | 828 | WP_090302201.1 | transporter substrate-binding domain-containing protein | - |
MYG64_RS28935 (MYG64_28825) | 208249..209529 | + | 1281 | WP_255382010.1 | FAD-binding oxidoreductase | - |
MYG64_RS28940 (MYG64_28830) | 209559..210530 | + | 972 | WP_060644205.1 | amino acid ABC transporter permease | - |
MYG64_RS28945 (MYG64_28835) | 210538..211410 | + | 873 | WP_255382013.1 | DMT family transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..1586769 | 1586769 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14783.84 Da Isoelectric Point: 4.6556
>T252193 WP_127890236.1 NZ_CP101519:206104-206523 [Ensifer adhaerens]
MIVLDTNVVSEAMKPAPDLAVRNWLNDQVAETLYLSSVTLAELLFGIAALPEGRRKKALADTLDGLLELFDDRVLSFDTA
AARHYADLAATARAGGKGFPTPDGYIAAIAASKGFTIATRDTSPFEAAGVPVVNPWNHL
MIVLDTNVVSEAMKPAPDLAVRNWLNDQVAETLYLSSVTLAELLFGIAALPEGRRKKALADTLDGLLELFDDRVLSFDTA
AARHYADLAATARAGGKGFPTPDGYIAAIAASKGFTIATRDTSPFEAAGVPVVNPWNHL
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|