Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 160077..160717 | Replicon | plasmid pB |
Accession | NZ_CP101519 | ||
Organism | Ensifer adhaerens strain NER9 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | MYG64_RS28710 | Protein ID | WP_060520810.1 |
Coordinates | 160077..160463 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A1G9VC88 |
Locus tag | MYG64_RS28715 | Protein ID | WP_034798574.1 |
Coordinates | 160463..160717 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MYG64_RS28690 (MYG64_28580) | 155661..156581 | - | 921 | WP_060520814.1 | ABC transporter permease subunit | - |
MYG64_RS28695 (MYG64_28585) | 156598..157713 | - | 1116 | WP_255381982.1 | sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | - |
MYG64_RS28700 (MYG64_28590) | 157742..158524 | - | 783 | WP_192439283.1 | GntR family transcriptional regulator | - |
MYG64_RS28705 (MYG64_28595) | 159726..159875 | - | 150 | Protein_146 | integrase | - |
MYG64_RS28710 (MYG64_28600) | 160077..160463 | - | 387 | WP_060520810.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MYG64_RS28715 (MYG64_28605) | 160463..160717 | - | 255 | WP_034798574.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
MYG64_RS28720 (MYG64_28610) | 161437..161682 | - | 246 | WP_060521307.1 | hypothetical protein | - |
MYG64_RS28725 (MYG64_28615) | 162459..163943 | + | 1485 | WP_082936527.1 | IS21 family transposase | - |
MYG64_RS28730 (MYG64_28620) | 163940..164821 | + | 882 | WP_255381985.1 | IS21-like element helper ATPase IstB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..1586769 | 1586769 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 13986.77 Da Isoelectric Point: 4.5034
>T252192 WP_060520810.1 NZ_CP101519:c160463-160077 [Ensifer adhaerens]
MVIDTSVLAAIAFNEPEAAAFRERIADDPVRLISAATVLEAAMVIETRLGEAAGADLDLWLYKAEVEIVPVTAEHSDRAR
RAWRRYGKGRHPASLNYGDCFSYALAALSGEPLLYKSNDFSQTDIEAA
MVIDTSVLAAIAFNEPEAAAFRERIADDPVRLISAATVLEAAMVIETRLGEAAGADLDLWLYKAEVEIVPVTAEHSDRAR
RAWRRYGKGRHPASLNYGDCFSYALAALSGEPLLYKSNDFSQTDIEAA
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|