Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1536970..1537676 | Replicon | plasmid pA |
Accession | NZ_CP101518 | ||
Organism | Ensifer adhaerens strain NER9 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | MYG64_RS26835 | Protein ID | WP_255381094.1 |
Coordinates | 1537233..1537676 (+) | Length | 148 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A1H0BN26 |
Locus tag | MYG64_RS26830 | Protein ID | WP_034800189.1 |
Coordinates | 1536970..1537236 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MYG64_RS26810 (MYG64_26720) | 1533308..1534357 | + | 1050 | WP_060529687.1 | ABC transporter permease | - |
MYG64_RS26815 (MYG64_26725) | 1534359..1535300 | + | 942 | WP_034800188.1 | ABC transporter permease | - |
MYG64_RS26820 (MYG64_26730) | 1535297..1536589 | + | 1293 | WP_255381093.1 | amidohydrolase family protein | - |
MYG64_RS26825 (MYG64_26735) | 1536637..1536791 | - | 155 | Protein_1389 | transcriptional regulator | - |
MYG64_RS26830 (MYG64_26740) | 1536970..1537236 | + | 267 | WP_034800189.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
MYG64_RS26835 (MYG64_26745) | 1537233..1537676 | + | 444 | WP_255381094.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MYG64_RS26840 (MYG64_26750) | 1537946..1538194 | + | 249 | WP_034800193.1 | hypothetical protein | - |
MYG64_RS26845 (MYG64_26755) | 1538413..1539453 | + | 1041 | WP_192441859.1 | ABC transporter substrate-binding protein | - |
MYG64_RS26850 (MYG64_26760) | 1539579..1540343 | + | 765 | WP_060529703.1 | ABC transporter permease | - |
MYG64_RS26855 (MYG64_26765) | 1540359..1541162 | + | 804 | WP_255381096.1 | ABC transporter permease | - |
MYG64_RS26860 (MYG64_26770) | 1541159..1542247 | + | 1089 | WP_034800202.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | katA | 1..1781172 | 1781172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 15655.14 Da Isoelectric Point: 6.9294
>T252190 WP_255381094.1 NZ_CP101518:1537233-1537676 [Ensifer adhaerens]
VSNLFMLDTNIVSELARNPRGQVAERIAAVGSEAICVSIITAAELRYGCAKKGSPKLLAQIEALLESILVLALDVPADAK
YGNIRTELEAAGKPIGPNDLLIAAHACAAGAVLVTANAREFTRIPNLRVENWLDATSKQLRVPPTER
VSNLFMLDTNIVSELARNPRGQVAERIAAVGSEAICVSIITAAELRYGCAKKGSPKLLAQIEALLESILVLALDVPADAK
YGNIRTELEAAGKPIGPNDLLIAAHACAAGAVLVTANAREFTRIPNLRVENWLDATSKQLRVPPTER
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|