Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 17408..18048 | Replicon | plasmid pA |
Accession | NZ_CP101518 | ||
Organism | Ensifer adhaerens strain NER9 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | MYG64_RS19950 | Protein ID | WP_060530470.1 |
Coordinates | 17408..17815 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | MYG64_RS19955 | Protein ID | WP_034805861.1 |
Coordinates | 17815..18048 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MYG64_RS19930 (MYG64_19875) | 13673..14587 | + | 915 | WP_034805874.1 | LysR substrate-binding domain-containing protein | - |
MYG64_RS19935 (MYG64_19880) | 14673..15215 | + | 543 | WP_255381133.1 | GNAT family protein | - |
MYG64_RS19940 (MYG64_19885) | 15209..16381 | - | 1173 | WP_060522056.1 | 4-hydroxybenzoate 3-monooxygenase | - |
MYG64_RS19945 (MYG64_19890) | 16510..17397 | + | 888 | WP_255381134.1 | helix-turn-helix domain-containing protein | - |
MYG64_RS19950 (MYG64_19895) | 17408..17815 | - | 408 | WP_060530470.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
MYG64_RS19955 (MYG64_19900) | 17815..18048 | - | 234 | WP_034805861.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
MYG64_RS19960 (MYG64_19905) | 18286..19734 | + | 1449 | WP_060530469.1 | NCS1 family nucleobase:cation symporter-1 | - |
MYG64_RS19965 (MYG64_19910) | 19782..20720 | - | 939 | WP_060530468.1 | sterol desaturase family protein | - |
MYG64_RS19970 (MYG64_19915) | 20720..21163 | - | 444 | WP_060530467.1 | hypothetical protein | - |
MYG64_RS19975 (MYG64_19920) | 21195..22664 | + | 1470 | WP_255381135.1 | amidase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | katA | 1..1781172 | 1781172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15138.25 Da Isoelectric Point: 7.9025
>T252188 WP_060530470.1 NZ_CP101518:c17815-17408 [Ensifer adhaerens]
MLKYMLDTNICIYTVKNRPQQVREAFNRHHGQLCISSVSLMELIYGAERSAMPERNLSVIEGFAARLEVLNYDQAAASHT
GQLRAELARSGTPIGPYDQLIAGHARSQGLILVTNNRREFDRVPGLRVEDWTAAP
MLKYMLDTNICIYTVKNRPQQVREAFNRHHGQLCISSVSLMELIYGAERSAMPERNLSVIEGFAARLEVLNYDQAAASHT
GQLRAELARSGTPIGPYDQLIAGHARSQGLILVTNNRREFDRVPGLRVEDWTAAP
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|