Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2441098..2441734 | Replicon | chromosome |
| Accession | NZ_CP101399 | ||
| Organism | Bacillus altitudinis strain HM-7 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | K2MHT4 |
| Locus tag | NM232_RS12835 | Protein ID | WP_003214169.1 |
| Coordinates | 2441384..2441734 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | W8QJ31 |
| Locus tag | NM232_RS12830 | Protein ID | WP_003214273.1 |
| Coordinates | 2441098..2441379 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NM232_RS12810 | 2437252..2437857 | - | 606 | WP_007496491.1 | rhomboid family intramembrane serine protease | - |
| NM232_RS12815 | 2437952..2438317 | + | 366 | WP_048001253.1 | holo-ACP synthase | - |
| NM232_RS12820 | 2438478..2439494 | + | 1017 | WP_007496489.1 | outer membrane lipoprotein-sorting protein | - |
| NM232_RS12825 | 2439623..2440804 | + | 1182 | WP_255233610.1 | alanine racemase | - |
| NM232_RS12830 | 2441098..2441379 | + | 282 | WP_003214273.1 | hypothetical protein | Antitoxin |
| NM232_RS12835 | 2441384..2441734 | + | 351 | WP_003214169.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| NM232_RS12840 | 2441849..2442679 | + | 831 | WP_007496484.1 | RsbT co-antagonist protein RsbRA | - |
| NM232_RS12845 | 2442684..2443052 | + | 369 | WP_003214235.1 | RsbT antagonist protein RsbS | - |
| NM232_RS12850 | 2443055..2443456 | + | 402 | WP_003214085.1 | anti-sigma regulatory factor | - |
| NM232_RS12855 | 2443467..2444474 | + | 1008 | WP_024425391.1 | PP2C family protein-serine/threonine phosphatase | - |
| NM232_RS12860 | 2444534..2444863 | + | 330 | WP_024425392.1 | anti-sigma factor antagonist | - |
| NM232_RS12865 | 2444860..2445348 | + | 489 | WP_178929502.1 | anti-sigma B factor RsbW | - |
| NM232_RS12870 | 2445314..2446102 | + | 789 | WP_012009000.1 | RNA polymerase sigma factor SigB | - |
| NM232_RS12875 | 2446102..2446701 | + | 600 | WP_008346897.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12976.99 Da Isoelectric Point: 5.1663
>T252134 WP_003214169.1 NZ_CP101399:2441384-2441734 [Bacillus altitudinis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEINAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEINAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | K2MHT4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A081L854 |