Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1523391..1524051 | Replicon | chromosome |
| Accession | NZ_CP101375 | ||
| Organism | Salmonella enterica strain SC2016090 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | Q57K70 |
| Locus tag | NMU33_RS07515 | Protein ID | WP_000244756.1 |
| Coordinates | 1523638..1524051 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S5MU13 |
| Locus tag | NMU33_RS07510 | Protein ID | WP_000351186.1 |
| Coordinates | 1523391..1523657 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMU33_RS07490 (1519319) | 1519319..1520752 | - | 1434 | WP_001230141.1 | 6-phospho-beta-glucosidase BglA | - |
| NMU33_RS07495 (1520911) | 1520911..1521222 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
| NMU33_RS07500 (1521386) | 1521386..1522045 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
| NMU33_RS07505 (1522161) | 1522161..1523141 | - | 981 | WP_000874172.1 | tRNA-modifying protein YgfZ | - |
| NMU33_RS07510 (1523391) | 1523391..1523657 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
| NMU33_RS07515 (1523638) | 1523638..1524051 | + | 414 | WP_000244756.1 | protein YgfX | Toxin |
| NMU33_RS07520 (1524104) | 1524104..1524625 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
| NMU33_RS07525 (1524738) | 1524738..1525634 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
| NMU33_RS07530 (1525658) | 1525658..1526371 | + | 714 | WP_000745625.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NMU33_RS07535 (1526377) | 1526377..1528110 | + | 1734 | WP_000813394.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T251993 WP_000244756.1 NZ_CP101375:1523638-1524051 [Salmonella enterica]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0YWH4 |