Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 335361..335947 Replicon chromosome
Accession NZ_CP101369
Organism Salmonella enterica strain SC2014238

Toxin (Protein)


Gene name doc Uniprot ID Q57IR9
Locus tag NMU30_RS01850 Protein ID WP_000174963.1
Coordinates 335579..335947 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID V7IU48
Locus tag NMU30_RS01845 Protein ID WP_001522145.1
Coordinates 335361..335582 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMU30_RS01820 (330382) 330382..331491 + 1110 WP_000822983.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
NMU30_RS01825 (331551) 331551..332477 + 927 WP_000003005.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NMU30_RS01830 (332474) 332474..333751 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
NMU30_RS01835 (333748) 333748..334515 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NMU30_RS01840 (334517) 334517..335230 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NMU30_RS01845 (335361) 335361..335582 + 222 WP_001522145.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NMU30_RS01850 (335579) 335579..335947 + 369 WP_000174963.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NMU30_RS01855 (336206) 336206..337522 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NMU30_RS01860 (337627) 337627..338514 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NMU30_RS01865 (338511) 338511..339356 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NMU30_RS01870 (339359) 339359..340429 + 1071 WP_000907842.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 325215..341166 15951


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13573.85 Da        Isoelectric Point: 6.7252

>T251923 WP_000174963.1 NZ_CP101369:335579-335947 [Salmonella enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8166.17 Da        Isoelectric Point: 5.0775

>AT251923 WP_001522145.1 NZ_CP101369:335361-335582 [Salmonella enterica]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5H6KCD5

Antitoxin

Source ID Structure

References