Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 86721..87433 | Replicon | chromosome |
| Accession | NZ_CP101369 | ||
| Organism | Salmonella enterica strain SC2014238 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A8F0CU93 |
| Locus tag | NMU30_RS00725 | Protein ID | WP_023216836.1 |
| Coordinates | 86721..87089 (-) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A8E7K1A9 |
| Locus tag | NMU30_RS00730 | Protein ID | WP_023216835.1 |
| Coordinates | 87104..87433 (-) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMU30_RS00695 (82254) | 82254..82385 | - | 132 | WP_023216841.1 | hypothetical protein | - |
| NMU30_RS00700 (82766) | 82766..83105 | + | 340 | Protein_78 | transposase | - |
| NMU30_RS00705 (83512) | 83512..84345 | - | 834 | WP_023216839.1 | DUF4942 domain-containing protein | - |
| NMU30_RS00710 (84499) | 84499..85221 | - | 723 | WP_077957236.1 | retron system putative HNH endonuclease | - |
| NMU30_RS00715 (85218) | 85218..85439 | - | 222 | WP_133297822.1 | hypothetical protein | - |
| NMU30_RS00720 (85424) | 85424..86627 | - | 1204 | Protein_82 | AAA family ATPase | - |
| NMU30_RS00725 (86721) | 86721..87089 | - | 369 | WP_023216836.1 | TA system toxin CbtA family protein | Toxin |
| NMU30_RS00730 (87104) | 87104..87433 | - | 330 | WP_023216835.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NMU30_RS00735 (87496) | 87496..87996 | - | 501 | WP_023216834.1 | DNA repair protein RadC | - |
| NMU30_RS00740 (88009) | 88009..88830 | - | 822 | Protein_86 | DUF945 domain-containing protein | - |
| NMU30_RS00745 (88915) | 88915..89829 | - | 915 | WP_023216831.1 | hypothetical protein | - |
| NMU30_RS00750 (89894) | 89894..90097 | - | 204 | WP_023216830.1 | hypothetical protein | - |
| NMU30_RS00755 (90114) | 90114..90260 | - | 147 | WP_023892166.1 | hypothetical protein | - |
| NMU30_RS00760 (90333) | 90333..91046 | - | 714 | WP_023216829.1 | WYL domain-containing protein | - |
| NMU30_RS00765 (91428) | 91428..91796 | + | 369 | WP_165850589.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 82254..100181 | 17927 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13735.76 Da Isoelectric Point: 9.0721
>T251921 WP_023216836.1 NZ_CP101369:c87089-86721 [Salmonella enterica]
MQNVLSLPSPAAASSRLSPVEAWQKLLSYLLQRHYGLELNDTPFCDDIVIQEHINAGVALADAVNFLVEKYGLVRIDRKG
FSWQEQSPYLRAVDILRARKATGLLTRCKKHNGNQPDGRFTL
MQNVLSLPSPAAASSRLSPVEAWQKLLSYLLQRHYGLELNDTPFCDDIVIQEHINAGVALADAVNFLVEKYGLVRIDRKG
FSWQEQSPYLRAVDILRARKATGLLTRCKKHNGNQPDGRFTL
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|