Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2752026..2752664 | Replicon | chromosome |
| Accession | NZ_CP101305 | ||
| Organism | Escherichia coli strain 2002-3211 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | NMK57_RS13725 | Protein ID | WP_000813794.1 |
| Coordinates | 2752488..2752664 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NMK57_RS13720 | Protein ID | WP_001270286.1 |
| Coordinates | 2752026..2752442 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMK57_RS13700 (2747178) | 2747178..2748119 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
| NMK57_RS13705 (2748120) | 2748120..2749133 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| NMK57_RS13710 (2749151) | 2749151..2750296 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| NMK57_RS13715 (2750541) | 2750541..2751947 | - | 1407 | WP_000760614.1 | PLP-dependent aminotransferase family protein | - |
| NMK57_RS13720 (2752026) | 2752026..2752442 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NMK57_RS13725 (2752488) | 2752488..2752664 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NMK57_RS13730 (2752886) | 2752886..2753116 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| NMK57_RS13735 (2753208) | 2753208..2755169 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NMK57_RS13740 (2755242) | 2755242..2755778 | - | 537 | WP_000429141.1 | DNA-binding transcriptional regulator SutR | - |
| NMK57_RS13745 (2755870) | 2755870..2757045 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T251869 WP_000813794.1 NZ_CP101305:c2752664-2752488 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT251869 WP_001270286.1 NZ_CP101305:c2752442-2752026 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|