Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 897786..898584 Replicon chromosome
Accession NZ_CP101305
Organism Escherichia coli strain 2002-3211

Toxin (Protein)


Gene name yeeV Uniprot ID A0A3W5Y7S6
Locus tag NMK57_RS04470 Protein ID WP_000854916.1
Coordinates 897786..898163 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A3W5Y7S1
Locus tag NMK57_RS04475 Protein ID WP_024174207.1
Coordinates 898210..898584 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMK57_RS04435 (893448) 893448..894161 - 714 Protein_873 DUF4942 domain-containing protein -
NMK57_RS04440 (894237) 894237..894911 + 675 WP_001341423.1 IS66-like element accessory protein TnpA -
NMK57_RS04445 (894908) 894908..895255 + 348 WP_000631725.1 IS66 family insertion sequence element accessory protein TnpB -
NMK57_RS04450 (895275) 895275..896831 + 1557 WP_001066422.1 IS66 family transposase -
NMK57_RS04455 (896864) 896864..897007 - 144 Protein_877 hypothetical protein -
NMK57_RS04460 (897092) 897092..897289 - 198 WP_000839246.1 DUF957 domain-containing protein -
NMK57_RS04465 (897301) 897301..897789 - 489 WP_000777666.1 DUF5983 family protein -
NMK57_RS04470 (897786) 897786..898163 - 378 WP_000854916.1 TA system toxin CbtA family protein Toxin
NMK57_RS04475 (898210) 898210..898584 - 375 WP_024174207.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NMK57_RS04480 (898747) 898747..898968 - 222 WP_000692312.1 DUF987 domain-containing protein -
NMK57_RS04485 (899037) 899037..899171 - 135 Protein_883 hypothetical protein -
NMK57_RS04490 (899212) 899212..900409 + 1198 Protein_884 IS3 family transposase -
NMK57_RS04495 (900487) 900487..900837 - 351 WP_000624681.1 IS66 family insertion sequence element accessory protein TnpB -
NMK57_RS04500 (900834) 900834..901259 - 426 WP_000422707.1 transposase -
NMK57_RS04505 (901391) 901391..901744 - 354 Protein_887 transposase -
NMK57_RS04510 (901782) 901782..902248 + 467 Protein_888 transposase -
NMK57_RS04515 (902253) 902253..902522 - 270 Protein_889 DDE-type integrase/transposase/recombinase -
NMK57_RS04520 (902785) 902785..903006 + 222 WP_024210032.1 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - eae / escD / sepL / espA / espD / espB / cesD2 / escF / escG / espF / espK 877155..909744 32589
- inside IScluster/Tn - - 891946..907276 15330


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14033.04 Da        Isoelectric Point: 9.1378

>T251859 WP_000854916.1 NZ_CP101305:c898163-897786 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIKAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITPGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13789.59 Da        Isoelectric Point: 6.7387

>AT251859 WP_024174207.1 NZ_CP101305:c898584-898210 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLTIYPTPATATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3W5Y7S6

Antitoxin

Source ID Structure
AlphaFold DB A0A3W5Y7S1

References