Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 846760..847544 Replicon chromosome
Accession NZ_CP101305
Organism Escherichia coli strain 2002-3211

Toxin (Protein)


Gene name yeeV Uniprot ID C7BUQ8
Locus tag NMK57_RS04150 Protein ID WP_000854717.1
Coordinates 846760..847086 (-) Length 109 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag NMK57_RS04155 Protein ID WP_001285487.1
Coordinates 847176..847544 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMK57_RS04120 (842055) 842055..843032 + 978 WP_000633206.1 type II secretion system minor pseudopilin GspK -
NMK57_RS04125 (843029) 843029..844207 + 1179 WP_000094965.1 type II secretion system protein GspL -
NMK57_RS04130 (844209) 844209..844745 + 537 WP_000942788.1 GspM family type II secretion system protein YghD -
NMK57_RS04135 (845088) 845088..845930 - 843 WP_024174205.1 DUF4942 domain-containing protein -
NMK57_RS04140 (846015) 846015..846212 - 198 WP_000839243.1 DUF957 domain-containing protein -
NMK57_RS04145 (846224) 846224..846712 - 489 WP_000761730.1 DUF5983 family protein -
NMK57_RS04150 (846760) 846760..847086 - 327 WP_000854717.1 TA system toxin CbtA family protein Toxin
NMK57_RS04155 (847176) 847176..847544 - 369 WP_001285487.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NMK57_RS04160 (847620) 847620..847841 - 222 WP_000692312.1 DUF987 domain-containing protein -
NMK57_RS04165 (847904) 847904..848380 - 477 WP_001186728.1 RadC family protein -
NMK57_RS04170 (848396) 848396..848869 - 474 WP_000855068.1 antirestriction protein -
NMK57_RS04175 (848963) 848963..849208 - 246 WP_032212706.1 hypothetical protein -
NMK57_RS04180 (849208) 849208..849516 - 309 Protein_822 DUF945 domain-containing protein -
NMK57_RS04190 (850798) 850798..851004 - 207 WP_000632607.1 AlpA family transcriptional regulator -
NMK57_RS04195 (851495) 851495..851668 + 174 Protein_825 N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-108)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 109 a.a.        Molecular weight: 12194.91 Da        Isoelectric Point: 6.4697

>T251858 WP_000854717.1 NZ_CP101305:c847086-846760 [Escherichia coli]
MKTLPDTHVREASRCPSPVIIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SACTHSQLINSIDILRARRATGLMTRDN

Download         Length: 327 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13737.53 Da        Isoelectric Point: 5.4844

>AT251858 WP_001285487.1 NZ_CP101305:c847544-847176 [Escherichia coli]
VSDTLHETNYPNDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB C7BUQ8

Antitoxin

Source ID Structure

References