Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 721924..722761 | Replicon | chromosome |
| Accession | NZ_CP101305 | ||
| Organism | Escherichia coli strain 2002-3211 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A7U9LL67 |
| Locus tag | NMK57_RS03535 | Protein ID | WP_000854687.1 |
| Coordinates | 722381..722761 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7U9LJJ3 |
| Locus tag | NMK57_RS03530 | Protein ID | WP_001443392.1 |
| Coordinates | 721924..722292 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMK57_RS03495 (717030) | 717030..717410 | + | 381 | Protein_686 | DUF945 domain-containing protein | - |
| NMK57_RS03500 (717923) | 717923..719701 | + | 1779 | WP_001243192.1 | reverse transcriptase/maturase family protein | - |
| NMK57_RS03505 (719820) | 719820..720260 | + | 441 | Protein_688 | DUF945 domain-containing protein | - |
| NMK57_RS03510 (720260) | 720260..720505 | + | 246 | WP_001164974.1 | hypothetical protein | - |
| NMK57_RS03515 (720599) | 720599..721072 | + | 474 | WP_000855068.1 | antirestriction protein | - |
| NMK57_RS03520 (721088) | 721088..721564 | + | 477 | WP_001186728.1 | RadC family protein | - |
| NMK57_RS03525 (721627) | 721627..721848 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| NMK57_RS03530 (721924) | 721924..722292 | + | 369 | WP_001443392.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NMK57_RS03535 (722381) | 722381..722761 | + | 381 | WP_000854687.1 | TA system toxin CbtA family protein | Toxin |
| NMK57_RS03540 (722758) | 722758..723246 | + | 489 | WP_001054228.1 | DUF5983 family protein | - |
| NMK57_RS03545 (723266) | 723266..723463 | + | 198 | WP_000772026.1 | DUF957 domain-containing protein | - |
| NMK57_RS03550 (723548) | 723548..724393 | + | 846 | WP_001274557.1 | DUF4942 domain-containing protein | - |
| NMK57_RS03560 (724693) | 724693..725199 | + | 507 | WP_000228937.1 | G/U mismatch-specific DNA glycosylase | - |
| NMK57_RS03565 (725278) | 725278..727119 | - | 1842 | WP_000437371.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14199.13 Da Isoelectric Point: 6.8615
>T251857 WP_000854687.1 NZ_CP101305:722381-722761 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFSDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVPSQLINSIDILRARRATGLMTRDNYRTVNNITLGRHPEEAKQ
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFSDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVPSQLINSIDILRARRATGLMTRDNYRTVNNITLGRHPEEAKQ
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LL67 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LJJ3 |