Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 488763..489561 | Replicon | chromosome |
| Accession | NZ_CP101302 | ||
| Organism | Escherichia coli strain 2000-3039 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0F3UPG9 |
| Locus tag | NMK59_RS02225 | Protein ID | WP_000854698.1 |
| Coordinates | 488763..489140 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0F3T7G0 |
| Locus tag | NMK59_RS02230 | Protein ID | WP_000017094.1 |
| Coordinates | 489187..489561 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMK59_RS02205 (484855) | 484855..486393 | - | 1539 | WP_001187182.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
| NMK59_RS02210 (487142) | 487142..487984 | - | 843 | WP_001280439.1 | DUF4942 domain-containing protein | - |
| NMK59_RS02215 (488069) | 488069..488266 | - | 198 | WP_000839251.1 | DUF957 domain-containing protein | - |
| NMK59_RS02220 (488278) | 488278..488766 | - | 489 | WP_001054226.1 | DUF5983 family protein | - |
| NMK59_RS02225 (488763) | 488763..489140 | - | 378 | WP_000854698.1 | TA system toxin CbtA family protein | Toxin |
| NMK59_RS02230 (489187) | 489187..489561 | - | 375 | WP_000017094.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NMK59_RS02235 (489636) | 489636..489857 | - | 222 | WP_001220316.1 | DUF987 domain-containing protein | - |
| NMK59_RS02240 (489926) | 489926..490402 | - | 477 | WP_001186195.1 | RadC family protein | - |
| NMK59_RS02245 (490417) | 490417..490902 | - | 486 | WP_000213700.1 | antirestriction protein | - |
| NMK59_RS02250 (490993) | 490993..491433 | - | 441 | Protein_434 | DUF945 domain-containing protein | - |
| NMK59_RS02255 (491552) | 491552..493330 | - | 1779 | WP_001243195.1 | reverse transcriptase/maturase family protein | - |
| NMK59_RS02260 (493843) | 493843..494220 | - | 378 | Protein_436 | DUF945 domain-containing protein | - |
| NMK59_RS02265 (494338) | 494338..494533 | - | 196 | Protein_437 | DUF905 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13975.94 Da Isoelectric Point: 7.9087
>T251825 WP_000854698.1 NZ_CP101302:c489140-488763 [Escherichia coli]
MKTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRSHYRTVNDITLGKRTEAKR
MKTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRSHYRTVNDITLGKRTEAKR
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13732.42 Da Isoelectric Point: 5.4488
>AT251825 WP_000017094.1 NZ_CP101302:c489561-489187 [Escherichia coli]
VSGTLHETNYPNDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSGTLHETNYPNDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0F3UPG9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0F3T7G0 |