Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 42272..42797 Replicon plasmid pEC21Z014-112K
Accession NZ_CP101276
Organism Escherichia coli strain EC21Z-014

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag NML17_RS24975 Protein ID WP_001159871.1
Coordinates 42492..42797 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag NML17_RS24970 Protein ID WP_000813630.1
Coordinates 42272..42490 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NML17_RS24950 (38087) 38087..38356 - 270 WP_000379710.1 SemiSWEET transporter -
NML17_RS24955 (38358) 38358..39374 - 1017 WP_016230896.1 Gfo/Idh/MocA family oxidoreductase -
NML17_RS24960 (39374) 39374..40204 - 831 WP_016230897.1 HAD-IIB family hydrolase -
NML17_RS24965 (40188) 40188..41426 - 1239 WP_024188128.1 DegT/DnrJ/EryC1/StrS family aminotransferase -
NML17_RS24970 (42272) 42272..42490 + 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NML17_RS24975 (42492) 42492..42797 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
NML17_RS24980 (42798) 42798..43607 + 810 WP_021514797.1 site-specific integrase -
NML17_RS24985 (43780) 43780..44133 + 354 WP_000864812.1 colicin M immunity protein -
NML17_RS24990 (44183) 44183..44998 - 816 WP_000449473.1 lipid II-degrading bacteriocin colicin M -
NML17_RS24995 (45241) 45241..45768 + 528 WP_000203268.1 colicin B immunity protein -
NML17_RS25000 (45786) 45786..47321 - 1536 WP_001282376.1 pore-forming bacteriocin colicin B -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / aadA5 / qacE / sul1 - 1..111893 111893


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T251787 WP_001159871.1 NZ_CP101276:42492-42797 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT251787 WP_000813630.1 NZ_CP101276:42272-42490 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References