Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 51884..52485 | Replicon | plasmid pEC21Z097-80K |
Accession | NZ_CP101248 | ||
Organism | Escherichia coli strain EC21Z-097 |
Toxin (Protein)
Gene name | doc | Uniprot ID | U9YA20 |
Locus tag | NML22_RS24245 | Protein ID | WP_001216045.1 |
Coordinates | 51884..52264 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | NML22_RS24250 | Protein ID | WP_001190712.1 |
Coordinates | 52264..52485 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NML22_RS24220 (NML22_24200) | 47325..48767 | - | 1443 | WP_001472843.1 | hypothetical protein | - |
NML22_RS24225 (NML22_24205) | 48809..50002 | - | 1194 | WP_000219625.1 | hypothetical protein | - |
NML22_RS24230 (NML22_24210) | 50088..50540 | - | 453 | WP_001326849.1 | late promoter-activating protein | - |
NML22_RS24235 (NML22_24215) | 50629..51672 | - | 1044 | WP_023356283.1 | DUF968 domain-containing protein | - |
NML22_RS24240 (NML22_24220) | 51700..51879 | - | 180 | WP_001339207.1 | hypothetical protein | - |
NML22_RS24245 (NML22_24225) | 51884..52264 | - | 381 | WP_001216045.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
NML22_RS24250 (NML22_24230) | 52264..52485 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NML22_RS24255 (NML22_24235) | 52558..52947 | - | 390 | WP_000506730.1 | S24 family peptidase | - |
NML22_RS24260 (NML22_24240) | 53122..53361 | + | 240 | WP_223368633.1 | hypothetical protein | - |
NML22_RS24265 (NML22_24245) | 53339..53713 | + | 375 | Protein_55 | integrase core domain-containing protein | - |
NML22_RS24270 (NML22_24250) | 54284..54889 | - | 606 | WP_254825251.1 | SGNH hydrolase domain-containing protein | - |
NML22_RS24280 (NML22_24260) | 55658..56917 | - | 1260 | WP_254825252.1 | acyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..80388 | 80388 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13588.29 Da Isoelectric Point: 5.1514
>T251648 WP_001216045.1 NZ_CP101248:c52264-51884 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CLP7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |