Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 74551..74815 Replicon plasmid pEC21Z144-121K-NDM5
Accession NZ_CP101223
Organism Escherichia coli strain EC21Z-144

Toxin (Protein)


Gene name pndA Uniprot ID E6BRV3
Locus tag NML25_RS25280 Protein ID WP_001303307.1
Coordinates 74663..74815 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 74551..74613 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NML25_RS25265 (69790) 69790..72081 - 2292 WP_001289276.1 F-type conjugative transfer protein TrbC -
NML25_RS25270 (72074) 72074..73144 - 1071 WP_000151582.1 IncI1-type conjugal transfer protein TrbB -
NML25_RS25275 (73163) 73163..74371 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- (74551) 74551..74613 - 63 NuclAT_0 - Antitoxin
- (74551) 74551..74613 - 63 NuclAT_0 - Antitoxin
- (74551) 74551..74613 - 63 NuclAT_0 - Antitoxin
- (74551) 74551..74613 - 63 NuclAT_0 - Antitoxin
NML25_RS25280 (74663) 74663..74815 + 153 WP_001303307.1 Hok/Gef family protein Toxin
NML25_RS25285 (74887) 74887..75138 - 252 WP_001291968.1 hypothetical protein -
- (75525) 75525..75576 - 52 NuclAT_1 - -
- (75525) 75525..75576 - 52 NuclAT_1 - -
- (75525) 75525..75576 - 52 NuclAT_1 - -
- (75525) 75525..75576 - 52 NuclAT_1 - -
NML25_RS25290 (76062) 76062..76238 - 177 WP_001054900.1 hypothetical protein -
NML25_RS25295 (76447) 76447..76656 - 210 WP_001140545.1 hemolysin expression modulator Hha -
NML25_RS25300 (76754) 76754..77368 - 615 WP_000578649.1 plasmid IncI1-type surface exclusion protein ExcA -
NML25_RS25305 (77444) 77444..79612 - 2169 WP_000698360.1 IncI1-type conjugal transfer membrane protein TraY -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid ant(3'')-Ia / aac(3)-IId / dfrA12 / aadA2 / qacE / sul1 / blaNDM-5 / rmtB / blaTEM-1B - 1..120930 120930


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5817.21 Da        Isoelectric Point: 8.7948

>T251565 WP_001303307.1 NZ_CP101223:74663-74815 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT251565 NZ_CP101223:c74613-74551 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A634Q5L1

Antitoxin

Download structure file

References