Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 74551..74815 | Replicon | plasmid pEC21Z144-121K-NDM5 |
| Accession | NZ_CP101223 | ||
| Organism | Escherichia coli strain EC21Z-144 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | NML25_RS25280 | Protein ID | WP_001303307.1 |
| Coordinates | 74663..74815 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 74551..74613 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML25_RS25265 (69790) | 69790..72081 | - | 2292 | WP_001289276.1 | F-type conjugative transfer protein TrbC | - |
| NML25_RS25270 (72074) | 72074..73144 | - | 1071 | WP_000151582.1 | IncI1-type conjugal transfer protein TrbB | - |
| NML25_RS25275 (73163) | 73163..74371 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (74551) | 74551..74613 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (74551) | 74551..74613 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (74551) | 74551..74613 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (74551) | 74551..74613 | - | 63 | NuclAT_0 | - | Antitoxin |
| NML25_RS25280 (74663) | 74663..74815 | + | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| NML25_RS25285 (74887) | 74887..75138 | - | 252 | WP_001291968.1 | hypothetical protein | - |
| - (75525) | 75525..75576 | - | 52 | NuclAT_1 | - | - |
| - (75525) | 75525..75576 | - | 52 | NuclAT_1 | - | - |
| - (75525) | 75525..75576 | - | 52 | NuclAT_1 | - | - |
| - (75525) | 75525..75576 | - | 52 | NuclAT_1 | - | - |
| NML25_RS25290 (76062) | 76062..76238 | - | 177 | WP_001054900.1 | hypothetical protein | - |
| NML25_RS25295 (76447) | 76447..76656 | - | 210 | WP_001140545.1 | hemolysin expression modulator Hha | - |
| NML25_RS25300 (76754) | 76754..77368 | - | 615 | WP_000578649.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| NML25_RS25305 (77444) | 77444..79612 | - | 2169 | WP_000698360.1 | IncI1-type conjugal transfer membrane protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | ant(3'')-Ia / aac(3)-IId / dfrA12 / aadA2 / qacE / sul1 / blaNDM-5 / rmtB / blaTEM-1B | - | 1..120930 | 120930 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T251565 WP_001303307.1 NZ_CP101223:74663-74815 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT251565 NZ_CP101223:c74613-74551 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|