Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4551601..4552470 | Replicon | chromosome |
| Accession | NZ_CP101210 | ||
| Organism | Escherichia coli strain EC21Z-147 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0U4BLW2 |
| Locus tag | NML26_RS22310 | Protein ID | WP_059309235.1 |
| Coordinates | 4552060..4552470 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | NML26_RS22305 | Protein ID | WP_254825012.1 |
| Coordinates | 4551601..4551969 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NML26_RS22265 (4547558) | 4547558..4548235 | + | 678 | WP_001097368.1 | hypothetical protein | - |
| NML26_RS22270 (4548241) | 4548241..4548474 | + | 234 | WP_001278287.1 | DUF905 family protein | - |
| NML26_RS22275 (4548564) | 4548564..4549382 | + | 819 | WP_001175153.1 | DUF932 domain-containing protein | - |
| NML26_RS22280 (4549408) | 4549408..4549548 | - | 141 | WP_000997937.1 | hypothetical protein | - |
| NML26_RS22285 (4549648) | 4549648..4550127 | + | 480 | WP_057109541.1 | antirestriction protein | - |
| NML26_RS22290 (4550143) | 4550143..4550619 | + | 477 | WP_059309238.1 | RadC family protein | - |
| NML26_RS22295 (4550682) | 4550682..4550903 | + | 222 | WP_059309237.1 | DUF987 domain-containing protein | - |
| NML26_RS22300 (4550922) | 4550922..4551551 | + | 630 | Protein_4368 | antitoxin of toxin-antitoxin stability system | - |
| NML26_RS22305 (4551601) | 4551601..4551969 | + | 369 | WP_254825012.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NML26_RS22310 (4552060) | 4552060..4552470 | + | 411 | WP_059309235.1 | TA system toxin CbtA family protein | Toxin |
| NML26_RS22315 (4552433) | 4552433..4552582 | + | 150 | Protein_4371 | DUF5983 family protein | - |
| NML26_RS22320 (4552658) | 4552658..4552855 | + | 198 | WP_085975623.1 | DUF957 domain-containing protein | - |
| NML26_RS22325 (4552940) | 4552940..4553781 | + | 842 | Protein_4373 | DUF4942 domain-containing protein | - |
| NML26_RS22330 (4554530) | 4554530..4556068 | + | 1539 | WP_001187191.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15234.33 Da Isoelectric Point: 6.8522
>T251527 WP_059309235.1 NZ_CP101210:4552060-4552470 [Escherichia coli]
MKLLPDTHVREASCCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITLGSIRGRNDETFPDAGSRQH
MKLLPDTHVREASCCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITLGSIRGRNDETFPDAGSRQH
Download Length: 411 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13730.53 Da Isoelectric Point: 6.4775
>AT251527 WP_254825012.1 NZ_CP101210:4551601-4551969 [Escherichia coli]
VSDTLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRADIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRADIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|